SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005769 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005769
Domain Number 1 Region: 28-521
Classification Level Classification E-value
Superfamily Sema domain 5.1e-176
Family Sema domain 0.0000000000776
Further Details:      
 
Domain Number 2 Region: 517-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000767
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 583-664
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000438
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005769   Gene: ENSTNIG00000003189   Transcript: ENSTNIT00000005917
Sequence length 741
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:57431068:57437271:1 gene:ENSTNIG00000003189 transcript:ENSTNIT00000005917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVTMTAPGAGLLLLALCVCRGCAVHSAPRVRLSFKELTDTKTARPFSFSFNTSDYRILL
MDQDQGRLYLGSREYLVALDMHNVNKEPLIIHWPASAKRKGECQMTGKGRQGECANFVRL
IEPWNRTHLYTCGTGAYQPICTFVNRGWRAEDYLFRLVPGFVESGKGKCSYDPKQENIAV
LLEGNLYAGVHIDFMSTDAALFRTMGGRTAIRTEQYDSRWLNEPVFVQIQQIPDSAERND
DKLYFFFREKSLDSSGGASPSILARVGRVCLNDEGGQKSLVNRWTTFLKARLICSVIGED
GVETRFDELRDVFIQPTQDERNPLVYGVFTTAGSVFRGSAVCVYSMADIRNVFNGPFAHK
HGHNYQWTEYTGKIPYPRPGTCPGGTFTPGIPSSKSFSDEAVNFIRSHPLMFQPVYPTHR
RPLVVRTGVDYRFTALVVDQVDAVDGRYEVLFLGTDQGTVQKVIVLPKDPTTMEELTLEE
VEVFRSKAAVKTMKISSKRQQLYVSSDAGLTQVSLHRCSVYGRACSDCCLARDPYCAWDG
ETCSAFTPSTKRRSRRQDVRHGDPLRQCRGFNAKVEKRLRETVQFGVEGSSTFLECQPRS
PQASLKWLFQGEGKRKLLSRAGGVLKTDHGILLKSLNQSDAGLYHCLATENNFKHTVARV
ALRILDRDIVLALTARDEEERKPQTEQAGPYAQSPAAPAPFPPEIRLINQYCQSYWDQLS
PKPQQQQRKRTSRRHTEGQDQ
Download sequence
Identical sequences H3CBZ7
ENSTNIP00000005769 99883.ENSTNIP00000005769 ENSTNIP00000005769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]