SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005775 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005775
Domain Number 1 Region: 38-220,476-568
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.17e-61
Family Ankyrin repeat 0.00026
Further Details:      
 
Domain Number 2 Region: 261-280,327-388
Classification Level Classification E-value
Superfamily TPR-like 0.0000797
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005775   Gene: ENSTNIG00000003195   Transcript: ENSTNIT00000005923
Sequence length 618
Comment pep:novel chromosome:TETRAODON8:12:7790072:7793414:1 gene:ENSTNIG00000003195 transcript:ENSTNIT00000005923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLKTAVFNAARDGKLRLLQKLLENKDGHEVTKLMGEKTNGATPLLMASRNGHLDLVEYL
LECCSAPIEVGGSVNFDGETIEGAPPLWAASAAGHLKVVQSLLGHGASVNSTTLTNSTPL
RAACFDGHLDIVKYLVEHKADLEVANRHGHTCLMISCYKGHKDIAQFLLQNGADVNRKSV
KGNTALHDCAESGSLEIMQMLLQYGASMEQDGYGMTPLLSASVTGHTNIVEYLTMHEQTR
HTARIDALELLGATFVDKKRDLLGALKYWKRAMDLRYMDSNNVVHKPEPKQLIMAYDYAK
EVTNGEELDGLISDPDEMRMQALLIRERILGPQHPDTSYYIRYRGAVYADSGNFERCINL
WKYALDMQQSNLDPLSPMTASSLLSFAELFSFMLQDRAKGLLGTSISFEDLMGILSKGVL
EIERAVKHSGPTALDPAQLSKALSIILHLICLLEKVPCTAEQDHFKKETIYRFLKLQPCG
KNGYSPLHLAVDRNTTCVGRYPVCKFPSLTVASILLECGADVNSRDNDDNSPLHIAASNG
HPDIMNLLISSGSHFDSTNAFQQTPCDLLDAKELSRNVIQPINHTTLQCLAARTIIKHSL
SYQGNIPEKLEAFILLHR
Download sequence
Identical sequences Q4T9H1
ENSTNIP00000005775 99883.ENSTNIP00000005775 ENSTNIP00000005775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]