SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005786 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005786
Domain Number 1 Region: 41-88
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 1.26e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 242-284
Classification Level Classification E-value
Superfamily UBA-like 0.0000306
Family CUE domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005786   Gene: ENSTNIG00000003206   Transcript: ENSTNIT00000005934
Sequence length 414
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:11258122:11259520:1 gene:ENSTNIG00000003206 transcript:ENSTNIT00000005934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSRIRPLGLPGHSLQVPASIMRPPPLFLRACSPALERGYPRTPKCARCRNHGVVSALKG
HKRFCRWKDCVCAKCTLIAERQRVMAAQVALRRQQAQEESEARERLLYPQASAAVGADAG
NPRGSPVGPGPSAAGHAPAPPSFEGFGTENPKDVSDDKSSKYNFYNGLLGRPFFAGHAAG
SLSSNDKKDLSPSRDGTVFSPDESASPSPPSPHTESPRSSPASDPESGCETEKANDSSGR
DRDPTDIMAKIFPHHKRDTLDSIVRTCRGDVVRSIELLMSSKEPQIDLETVAPSPQPSAL
GSSVGVPAAVGALGTKSAFSPLHLPPAAPVGEGLYGLSPRLGVGPLRLTYTSSSGGMAGF
MSPYVTSGLMPMFPLRPPLDTYSFPGMIRDFSYLPSKEALCSTGLYARVNSEKK
Download sequence
Identical sequences H3CC14
ENSTNIP00000005786 99883.ENSTNIP00000005786 ENSTNIP00000005786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]