SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005791 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005791
Domain Number 1 Region: 14-164
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-29
Family C-type lectin domain 0.00000888
Further Details:      
 
Domain Number 2 Region: 357-422
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 294-361
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000403
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 563-623
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 479-545
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 245-305
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000057
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 7 Region: 418-483
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 8 Region: 177-243
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000639
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 9 Region: 613-678
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000133
Family Complement control module/SCR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005791   Gene: ENSTNIG00000019644   Transcript: ENSTNIT00000005939
Sequence length 679
Comment pep:known_by_projection chromosome:TETRAODON8:1:14746634:14757484:-1 gene:ENSTNIG00000019644 transcript:ENSTNIT00000005939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSVLCMRTSVECWSYHYSNTTMDWTQARAWCQEHYTDLVAIQNKEEIEHLNNWLPERKG
YYWIGIRKINNIWTWVGTNKVLTEEATNWAENEPNNGREGKRQKSRQEDCVEIYIKRSKE
PGKWNDESCSKTKTALCYTASCLQNSCSAHAECVETVGNYTCQCHPGFQGPLCEEAIACQ
PLLDPEQGFQHCFHPHGCLNSSCNFQCILGFRLVGASQLVCQASGHWNNPVSLCQIQECP
FLNQTISAGSIICSPPDAPYSYNSTCEVRCDEGYEASGQNHLQCDHTGQWSASVPACTVK
KCPPILFPFPGNLTCVDTLEPFSFGSWCSFTCQKGHTLVGEATMTCQASGEWSSSTPRCA
VVQCNRLKAPHNAIISCENPLGEHSYGSTCTVECNKGFDLIGTNTTKCSSQGQWSPQLPV
CQARKCHPVDLPRGFLSCFNPNGPFTFGSLCTATCERGFALNGTVSIECSSLGLWSADIP
QCSAKQCPALGSPAHGSLVCSAPHGEFSFGAQCGSTCEDGFLLNGTAETECTSQGVWSTE
TPHCLGIGLMPSIARPCPLLAKAPPNGTLTCSHPHSHSSYGSQCEFECDVGFWSKGASAI
TCNSSGVWSQDPPTCQPLQCEAIRVFSSSLYVNCSHPVEELSFGSQCFFSCKEGFSLNGT
QTLTCTSAVFWSDTPPTCR
Download sequence
Identical sequences H3CC19
99883.ENSTNIP00000005791 ENSTNIP00000005791 ENSTNIP00000005791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]