SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005831 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000005831
Domain Number - Region: 287-310
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0136
Family HIT zinc finger 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005831   Gene: ENSTNIG00000003248   Transcript: ENSTNIT00000005979
Sequence length 314
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:1329331:1331032:-1 gene:ENSTNIG00000003248 transcript:ENSTNIT00000005979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHPRFLNEGNSSLHSVHKRKHKKHKKHKKKHHSFAEAPEPEPVVMPRPPPQLRLKIKLG
GQTLGTKSVPTFTVHPGVACPPSPLLIIHNDIDPSVPLEQYRAWLALDEDSNLATSPMPD
MDSDSLLGGPVDEEERWLDALEKGELDDNGELKKEVDESLLTARQKALLHKQQSQPLLEL
PMGYKEKEMTAEMMQKREERARKRRLQAAKKAEENKNQTIERLTKTSKTKIKSMKERKSK
QNQCPMIRYSDSARGVAVSFPAGVPAPAPAPPRPTPTTRVSCGVGGCTNLKKYSCSKTGV
PLCSLDCYKRNLVL
Download sequence
Identical sequences H3CC59
ENSTNIP00000005831 ENSTNIP00000005831 99883.ENSTNIP00000005831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]