SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005835 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005835
Domain Number 1 Region: 209-519
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.58e-111
Family Transglutaminase core 0.00000000307
Further Details:      
 
Domain Number 2 Region: 27-207
Classification Level Classification E-value
Superfamily E set domains 1.54e-46
Family Transglutaminase N-terminal domain 0.0000362
Further Details:      
 
Domain Number 3 Region: 533-643
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.7e-28
Family Transglutaminase, two C-terminal domains 0.00014
Further Details:      
 
Domain Number 4 Region: 644-742
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.67e-23
Family Transglutaminase, two C-terminal domains 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005835   Gene: ENSTNIG00000003252   Transcript: ENSTNIT00000005983
Sequence length 743
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:1304183:1308440:1 gene:ENSTNIG00000003252 transcript:ENSTNIT00000005983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPASTVDSSPAPTAPTGPRPKVTNRGRTAFAVASSNSDSTEVPEFEPFIAPGPRGFPP
MTEFLDILEVDMVSKFEEINKQEHRTEFYDSNFLIVRRGQEFQVKITFNRPYKPKDKFAL
EFVIGTNPDYNKGTYIPIFPNKDRKSRWPGRITNTSDSVLTIGITPLANCIVGKYHMYVA
VMTPFGIRRTKKESTRDLYILFNPWSPADDVFLDDEPERQECVINETGIIYHGAYDDVAE
RHWNYGQFNYGVLDACLYIMDRSEMPITNRGDPIKVTRKASAMLNSRDDDGVLVGNWSGD
YTYGVAPTSWTGSTEILLTYASSKTPVGYAQCWVYAAVFNTFLRCLGIPSRVVTNYYSAH
DNDGNLKTDIILHENGKIDRTRTRDSIWNYHCWNECFMTRPDLPAGFGGWQVVDATPQET
SDAKGLYRCGPASVLAIKHGELCYPFDAGFVFAEVNSDVVFYSRGKDGAMQPVRVNQTHV
GRMVLTKAAGDTTRRDITSQYKFPEGTSEERTVLEKAEGFGCHREKSRPLEADVDLVLPT
LEVAIGDDFELSLGFKNRSDQQRVVEAYISGNVVYYTGVSSAEFMLREPTVTLKPNESVN
ELVVVESKKYMKHLVEQASLHFIVTGKVKETGQILTAMKVVRLHNPKLSVKVSGANRVSE
EMMVMVEFINPFSFALAEVYIRMEGAGVMMPKFKYYSLIPKGSSLIWTEFFVPKRAGTTR
VFATLDCPKLRQVQGEASLTIEP
Download sequence
Identical sequences H3CC63
ENSTNIP00000005835 ENSTNIP00000005835 99883.ENSTNIP00000005835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]