SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005840 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005840
Domain Number 1 Region: 539-751
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-51
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 228-371
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-43
Family Third domain of FERM 0.00056
Further Details:      
 
Domain Number 3 Region: 887-1029
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-33
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Domain Number 4 Region: 736-859
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-31
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 5 Region: 130-230
Classification Level Classification E-value
Superfamily Second domain of FERM 5.23e-25
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 6 Region: 51-122
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000372
Family First domain of FERM 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005840   Gene: ENSTNIG00000003257   Transcript: ENSTNIT00000005988
Sequence length 1029
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:57858864:57877864:1 gene:ENSTNIG00000003257 transcript:ENSTNIT00000005988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDIEGSYRVLQTPGTRLGAQFNAGISTLEPGQSLAGNMISSHRNFGRTLQIRVHGLDDS
QEFFDMDPKALGQSLLSEVFFRGNLIESDYFGLEFQNILMNWVCKEAFVFTHTHTHTCTF
IFDCWHVNRTYLTETNKRYLFSLQMKRDLMEGRLICTENTGALLVSHLVQAEMGDYDDVA
DRDFLRMHKFLPYQEKVQERIMELHCRHQGQTPAESDFQILEIARKLEMYGVRFHPAADR
EGTKINLSVSHMGLQVFQGHTKINTFNWSKIRKLSFKRKWFLIKLHPEVHGPHQDTLEFL
MASRDQCKIFWKICVEYHSFFRLFDQPQPKTKAIFTRGSSFRYSGRTQKQLVEFIRENGS
KRTAYQRRNSKIRMSARSVATEVPTQLLQLVSEENKRQTRISSGPVGEGPSVHFADLCVT
KQQGKPGDRSLPRSASPWHDCSKRKKDQRDEDAQSSVASSRFSLFRPEMVIIPADSVVDS
PQLLPFSAQGPLSPSLQMSNLSLSGQAPSPLQSPILSEVGNNVRLEEEEEGRRKRYPTDK
AYFIAKEILTTERTYLKDLEVITVWFRSAVIKENAMPEGLMTLLFSNIDPIYEFHRDFFK
ELDQRLALWEGRSNAHVKGDCQRIGDVMLRNMCALKEFTSYLQKHDEVLTELEKATKRMK
KLETVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILERLCKHYSPTHRDHDDCKEALKE
VADIAAQLQSSLIRLENFQKLTELQRDLIGIENLTAPGRKFIREGCLYKLTKKGLQQRMF
FLFSDMLLYTSKGVTATNQFKVHGQLPLHGMIVEESENEWSVPHCFTIYSAQRTVVVAAS
SKVEMGKWIEDLNMAIDMARTSQEKSSVFLDGGLGDHSNRSSDEVSVEQESEEDINSSRT
SLDKQAHHRANTTIHVCWHRNTSVSMSDHSLAVENQLSGYLLRKFKNSNGWQKLWVVFTN
FCLFFYKTHQDDFPLASLPLLGYTVGTPEESDSIHKEYVFKLQFKSHVYFFRAESEYTFE
RWMEVIKSA
Download sequence
Identical sequences H3CC68
ENSTNIP00000005840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]