SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005891 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005891
Domain Number 1 Region: 380-487
Classification Level Classification E-value
Superfamily Second domain of FERM 9.55e-29
Family Second domain of FERM 0.00051
Further Details:      
 
Domain Number 2 Region: 488-596
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-24
Family Third domain of FERM 0.0047
Further Details:      
 
Domain Number 3 Region: 683-788
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-20
Family PDZ domain 0.0067
Further Details:      
 
Domain Number 4 Region: 852-958
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-19
Family PDZ domain 0.0027
Further Details:      
 
Domain Number 5 Region: 989-1089
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-19
Family PDZ domain 0.018
Further Details:      
 
Domain Number 6 Region: 292-378
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.21e-18
Family First domain of FERM 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005891
Domain Number - Region: 11-132
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000341
Family Protein kinases, catalytic subunit 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005891   Gene: ENSTNIG00000003307   Transcript: ENSTNIT00000006039
Sequence length 1093
Comment pep:novel chromosome:TETRAODON8:2:5287884:5296712:1 gene:ENSTNIG00000003307 transcript:ENSTNIT00000006039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQCWVVCRMGTFVTLAEVLEARGSPLDEDEVWCLLLATTEALLDISQKGNMCNVLSPGSV
LLSDNGNLAFKSCARYENVASFRAPEVQQGLTSFSRNAAEKPVHLSSELEGLLLSMCEDV
ASRRTDLLTVLETCGLRHRASMLPPAERLIRKLVEEVYRTSQADHIPVAENGSELTDRSQ
MIRDRLHKHSLDHASPQGKQIFSRIPSGIQQRESYSSWQQLNRSPCSQYMDSNRNSTSKS
LSQFESTISLNEKKVKEQCPEFIRMLDEPQVVLELPLSIVVRKKGKSLSSQRELNVVMPN
GQSILVKCEVKARGGDVFDMIVAHSNLMEHFYFGLAYIDDSEFFFVDNDTKISKVAPDSW
KKVPTTTFVLYFRIKFYVNDISLLLHKQTCHQYYLQLRRDLLEDRLCCHEDTALYLGALA
LQTEFGDCMPEVYGRNYFRPDQYVPKSVMEKRALPYIQGELTRLHANNAQMLAQESELEF
LKVCQQLPEYGVMFHQVTREKKPHEGEIVLGVCAKGVILYEIKDGCRSSSQNFLWRETST
ISSSRRKFIVESRVSKKKHTFITERSKTAKYLCNLCSAQHKFNNEMNSRQLTQSLVSEGN
MSQYTAACRTQSSCLKSFSCSETPQDESGLTTPRDDTLTKLCNDVTSRIETRLKQQHQNL
SEQSTWSSSQRSSTSMRSPAFSLRSGSEAPSSLLAAREREVLCVSLRKDPKLGLGIVIVG
EEAVGHFDLGIFVASIVPNGPADRDGRIRPGGRLISLNISLERVTFSEAAEVIQNSPEEV
QLIISQPKGALFASTFVNPLSLRSSSLRNCESPLVADRRSADESLDEITSVTMTPKTCNR
LHIPQEVLGAQDGSSLSPPLNCRPQEISLELRKISGSLGLSITACLSNNLSSGRIYIRSL
VPGGDAEKERPLPDGDRLLEVDGISFRGFSYQQAVDCLSKTGEVVTLVVERRKLRPSMTN
PPSFRENIGQRQQKTFRITCMAQPGHSGSCKENTQEVTLTKSDGGFGFSFLMCELDPPTR
DFGTLVRIKKLFPGQPAQQSGRILEGDVLLAINGQSLKKLTYPAVLKLFKTSPPEVHLTL
CRPAPGVLPSIEQ
Download sequence
Identical sequences H3CCB9
ENSTNIP00000005891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]