SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005892 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005892
Domain Number 1 Region: 390-497
Classification Level Classification E-value
Superfamily Second domain of FERM 9.68e-29
Family Second domain of FERM 0.00051
Further Details:      
 
Domain Number 2 Region: 498-606
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-24
Family Third domain of FERM 0.0047
Further Details:      
 
Domain Number 3 Region: 693-798
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-20
Family PDZ domain 0.0067
Further Details:      
 
Domain Number 4 Region: 862-968
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-19
Family PDZ domain 0.0027
Further Details:      
 
Domain Number 5 Region: 999-1099
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-19
Family PDZ domain 0.018
Further Details:      
 
Domain Number 6 Region: 302-388
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.22e-18
Family First domain of FERM 0.01
Further Details:      
 
Domain Number 7 Region: 2-142
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000512
Family Protein kinases, catalytic subunit 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005892   Gene: ENSTNIG00000003307   Transcript: ENSTNIT00000006040
Sequence length 1103
Comment pep:novel chromosome:TETRAODON8:2:5287920:5296712:1 gene:ENSTNIG00000003307 transcript:ENSTNIT00000006040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTLAEVLEARGSPLDEDEVWCLLLATTEALLDISQKGNMCNVLSPGSVLLSDNGNLAFKS
CARYENVASFRAPEVQQGLTSFSRNAAEKMVVYSLGMTLYWCVDYHLPQNQPVHLSSELE
GLLLSMCEDVASRRTDLLTVLETCGLRHRASMLPPAERLIRKLVEEVYRTSQADHIPVAE
NGSELTDRSQMIRDRLHKHSLDHASPQGKQIFSRIPSGIQQRESYSSWQQLNRSPCSQYM
DSNRNSTSKSLSQFESTISLNEKKVKEQCPEFIRMLDEPQVVLELPLSIVVRKKGKSLSS
QRELNVVMPNGQSILVKCEVKARGGDVFDMIVAHSNLMEHFYFGLAYIDDSEFFFVDNDT
KISKVAPDSWKKVPTTTFVLYFRIKFYVNDISLLLHKQTCHQYYLQLRRDLLEDRLCCHE
DTALYLGALALQTEFGDCMPEVYGRNYFRPDQYVPKSVMEKRALPYIQGELTRLHANNAQ
MLAQESELEFLKVCQQLPEYGVMFHQVTREKKPHEGEIVLGVCAKGVILYEIKDGCRSSS
QNFLWRETSTISSSRRKFIVESRVSKKKHTFITERSKTAKYLCNLCSAQHKFNNEMNSRQ
LTQSLVSEGNMSQYTAACRTQSSCLKSFSCSETPQDESGLTTPRDDTLTKLCNDVTSRIE
TRLKQQHQNLSEQSTWSSSQRSSTSMRSPAFSLRSGSEAPSSLLAAREREVLCVSLRKDP
KLGLGIVIVGEEAVGHFDLGIFVASIVPNGPADRDGRIRPGGRLISLNISLERVTFSEAA
EVIQNSPEEVQLIISQPKGALFASTFVNPLSLRSSSLRNCESPLVADRRSADESLDEITS
VTMTPKTCNRLHIPQEVLGAQDGSSLSPPLNCRPQEISLELRKISGSLGLSITACLSNNL
SSGRIYIRSLVPGGDAEKERPLPDGDRLLEVDGISFRGFSYQQAVDCLSKTGEVVTLVVE
RRKLRPSMTNPPSFRENIGQRQQKTFRITCMAQPGHSGSCKENTQEVTLTKSDGGFGFSF
LMCELDPPTRDFGTLVRIKKLFPGQPAQQSGRILEGDVLLAINGQSLKKLTYPAVLKLFK
TSPPEVHLTLCRPAPGVLPSIEQ
Download sequence
Identical sequences H3CCC0
ENSTNIP00000005892 ENSTNIP00000005892 99883.ENSTNIP00000005892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]