SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005968 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005968
Domain Number 1 Region: 29-216
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.58e-52
Family Tpt1/KptA 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005968   Gene: ENSTNIG00000003381   Transcript: ENSTNIT00000006116
Sequence length 231
Comment pep:novel chromosome:TETRAODON8:Un_random:58728260:58730497:-1 gene:ENSTNIG00000003381 transcript:ENSTNIT00000006116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAECNVGQRSGRTGGRRRRGNRGDEDGDVRLSKSLSYALRHGANQMGLQIGSDGFVFVEE
LLAHPQFRSYSLEDVERVVNTNDKQRFKLRSHRENGCLQIRASQGHSIKVIDLELKPVLA
GSPECPAEAVHGSYLRNWGSIKQQGLSRMNRTHIHLAPGLPGEDGVISGMRKDCDLAVFV
DVPKALADGLEFFWSENGVLLTAGNTEGMLPPKYFSRALRLKPTRSLLSLL
Download sequence
Identical sequences Q4T8R7
99883.ENSTNIP00000005968 ENSTNIP00000005968 ENSTNIP00000005968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]