SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005989 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005989
Domain Number 1 Region: 11-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.43e-70
Family BAR domain 0.0000000636
Further Details:      
 
Domain Number 2 Region: 291-349
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-17
Family SH3-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005989   Gene: ENSTNIG00000003402   Transcript: ENSTNIT00000006137
Sequence length 352
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:30493873:30498001:-1 gene:ENSTNIG00000003402 transcript:ENSTNIT00000006137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKASQLLSEKISGAEGTRLEEDFVEMERKIDVTNKSIVELLSKTIEYLQP
NPASRAKLNMLNTVSRIRGQVRTNGYPQAEGLLGDCMLRYGQELGEDSVFGGALVETGEG
LRQMADVKDALDVSVKQNFIDPLQNLQDKELKEITHHLKKLEGRRLDFDYKKKRQGKIPG
DEIQQAAEKLEESKALAERSMFNFLESDMEQVSQLASLIEAAKEYHRQSCKILEELFGKL
QKRISSASFHPRKEFKPKSIREAMTVFDNSPHDSPSRSASMKSSGPASEVLDQPCCRSLY
DFEPENEGELGFKEGDVIILTNQIDENWYEGMIHGRAFFPISYVEVMVPLPQ
Download sequence
Identical sequences H3CCL6
ENSTNIP00000005989 ENSTNIP00000005989 99883.ENSTNIP00000005989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]