SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006006 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006006
Domain Number 1 Region: 337-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000271
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 2 Region: 133-264
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000863
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 260-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000385
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 4 Region: 298-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000049
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 5 Region: 428-460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000028
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 6 Region: 30-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000144
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 107-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family EGF-type module 0.017
Further Details:      
 
Domain Number 8 Region: 375-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000752
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006006
Domain Number - Region: 72-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000225
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006006   Gene: ENSTNIG00000003419   Transcript: ENSTNIT00000006154
Sequence length 460
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:58895557:58900662:-1 gene:ENSTNIG00000003419 transcript:ENSTNIT00000006154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGTKMALNLKTLLLTMTMFKWGILCTATSDRCLSGPCQNGASCVDTVDDYACICPTAGV
RYMGKNCDQLYDACFFAPCENCSSTPGSAEYRCICADGLTGDNCTEEVDECLSGPCSWPR
SLCVDQPNRYFCRCPEGFGGRDCRTHVTDCIDAPCENNGTCVLQPEGFECVCAPGFEGKM
CEEDVDECLSEPCQNGAICTNGVAEFHCFCVPGFQGYNCELDINECASRPCENNATCINE
KDHYQCECLGGFAGVNCERETDECESSPCRNGATCRDLVGMYACECVPGFHGPDCSLDVD
ECASEPCQNGAACHDMVNSYDCDCSETGFEGDHCETDVPECASNPCQHGGRCLEQVKGYA
CVCWPGYQGANCETDINECAEQPCENGECFERSDPSYWEADWEVTFADLAGYLCQCHPGF
AGENCSVNIDECESEPCQNGATCEDLTNAYSCLCSAGFQG
Download sequence
Identical sequences H3CCN3
99883.ENSTNIP00000006006 ENSTNIP00000006006 ENSTNIP00000006006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]