SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006011 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006011
Domain Number 1 Region: 3-152
Classification Level Classification E-value
Superfamily E set domains 1.26e-26
Family Arrestin/Vps26-like 0.018
Further Details:      
 
Domain Number 2 Region: 152-295
Classification Level Classification E-value
Superfamily E set domains 4.9e-17
Family E-set domains of sugar-utilizing enzymes 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006011   Gene: ENSTNIG00000003424   Transcript: ENSTNIT00000006159
Sequence length 438
Comment pep:known_by_projection chromosome:TETRAODON8:4:9386747:9403198:1 gene:ENSTNIG00000003424 transcript:ENSTNIT00000006159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKLQEFDITFTNNKVVYGPGESISGTVKIRTSSSLPYKVIKVNCQGSCGISNKLNDSSW
AMEEQYFNSTLSVADKGTLAAGEHCFPFQFVIPVAVPTSFEGPFGKVSYRVKAVIDTPRF
SKDYKAQKPFYLLNLLNLNEVPDIEHPNYAVITKKFNYLLLKTGTLMLKTRSDLRGYIPG
QVIRLATEIHNKSGKDTGCVLASLIQKVSYKTRRPLFDLRTIAEVEGAGVKAGKHAEWRE
QIIVPPLPQSALAGCSLIDIEYFIQVSLKSPDAVVTLPIYIGNIPVNLSPSRTTPSSPVQ
GGANIASPGVTPSAPPAEDDPQERLCAGGLDNEEISTKSHSQQDPSCQPVTMSPSAFSHA
PGAAVPPSHRQPNASAPLFCVSTGATIPFFTEGNVTPIPTSCSLILPPEYSSWDYPHEPP
PTYEESCSSANSNLDSRQ
Download sequence
Identical sequences H3CCN8
ENSTNIP00000006011 99883.ENSTNIP00000006011 ENSTNIP00000006011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]