SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006023 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006023
Domain Number 1 Region: 4058-4425
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.5e-97
Family Regulator of chromosome condensation RCC1 0.0049
Further Details:      
 
Domain Number 2 Region: 366-735
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.49e-95
Family Regulator of chromosome condensation RCC1 0.00072
Further Details:      
 
Domain Number 3 Region: 4557-4901
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.14e-89
Family Hect, E3 ligase catalytic domain 0.00007
Further Details:      
 
Domain Number 4 Region: 3479-3581,3636-3766,3794-3872
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.95e-38
Family WD40-repeat 0.0084
Further Details:      
 
Domain Number 5 Region: 2021-2204
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-34
Family SPRY domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006023
Domain Number - Region: 1731-1990
Classification Level Classification E-value
Superfamily ARM repeat 0.00132
Family Regulatory subunit H of the V-type ATPase 0.048
Further Details:      
 
Domain Number - Region: 2795-2854
Classification Level Classification E-value
Superfamily UBA-like 0.00628
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006023   Gene: ENSTNIG00000003436   Transcript: ENSTNIT00000006171
Sequence length 4925
Comment pep:known_by_projection chromosome:TETRAODON8:5:12781642:12808637:-1 gene:ENSTNIG00000003436 transcript:ENSTNIT00000006171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTIPPVKLKWLEHLNSSWITEDSESIATREGVAVLYAKLLANKEAVLLPQQVLCLKGP
QLPDFERESLSSDEQEHYLDALLGSQLALAKMVCSDSPFAAALRKRVLVLQRIFYALSNK
YHDQGKVKQQQHSPENNAGSADMHSVSERPRSSTDALIEMGVRTGLSLLFALLRQSWMIS
GGYPAANMNLCNDVIHTAIEVVNSLPPLSLANESKIPAMGLDCLAQVTTFLKGVTMPNSG
ADVLGRRLASELLLGLASQRGSLRYLLEWIEMALAASAVVSTMAESKAWNQEGLIGYDCF
MSILMQMRRSLGSAADRSQWREPTRTSEGLCSLYEAALCLFEEVCRMASDYSRTCVSPDS
IQTGEAPVVSETCEVYVWGSNSSHQLVEGTQEKILQPKLAATFADAQTIEAGQYCTFVIS
SDGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRAIKKVSSSKGSDGHTLAFTTEGEV
FSWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVSEDGELYTWGEGD
FGRLGHGDSNSRNIPTLVKDISNVGEVSCGSSHTIALSKDGRTVWSFGGGDNGKLGHGDT
NRVYKPKVVEALQGMFIRKVCAGSQSSLALTSTGQVYAWGCGACLGCGSSEATALRPKLI
EELATTRVVDISIGDSHCLALSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVVGLDGVA
IQQISAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLERYCDGINSDVPPL
PFPSSREHHHFLKLCLRLLSNHLALALAGGVATSILGRQARPLRNLLFRLMDSSVPDEIQ
EVVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQRMQLDIILTSLQDHTHV
ASLLGYSSPTDGPELLPSGPGFMASPEPTYGIMSDHPDTHLAEILMKTLLRNLGFYTDQA
FGELEKNSDKLQRGTSSSDSSQPAHLHQLLCSLQKQLLAYCHINSVSENSSSVALLHKHL
QLLLPHATDIFSRSATLIKESSWNGSIQEKLQDVIYVSAAGSMLCQIVNSLLLLPVSVAR
PLLSHLLDLLPPLDRLNRLLPAASPLEDQELQWPLHGASDFAEPASGMSLPQPALSWVWL
VDLERTVALLVGRCLGGMLQGAPTSLEEQDTAYWLKTPLFSNGLEMESPRLDASISSLLE
AALSGNEEQKPFECTLHPDMSVLVDLALGSSKEPVNSLWINMQDYAISKDWDNVSLSNET
LLDTVSRFVLAALLKHTGLLAQGCGEGRYQPSKSLAEVYRSVYKVRNRLLACKNMDFIQT
RSSSRERRISDNQDSLEMDPQEHSVTRTIDEEAELEERADREREEGHQEQEDEEEDRDHE
VLTAGKIFQCFLSAREVARTRDRERSNSSSPGGRGGEDEAMLGQEGRRGSSALPEGQDLY
TAACNSVIHRCALLLLGVSPVLGELSKQNQEEGQAQSATGTQECLSFMTRSESLSAESRL
VQSSPSYRLMKSRSESDLSQPESDEEGYTLSGRRNMDLDLAFSQKKRGLLHSSPDSLAES
WFRAKLSRQRSYGSGHPYEESDLDLSGSLGIHALIDNMVSFISGDVGLAPAFKEPEESMS
TSPQALILAMEQQQSRAELRLEALHQIVVLISGMEEKGSQTGGSERSAASFQSSSLLTSV
RLQFLAGCFGLGTVGAGGLKRESVQLHHYQDGVKSAKRSIQMEIQTAVHKIYQQLSVTLE
RALQANKHHIDLEAQQRLLLVTVFALSVRYQPVDVSLAISSGLLNVLSQLCGTETMLGQP
LQLLQKPGVSQLSTALKVASTRLLQILAISTGTYADKLSPKVVQSLLDLLCSQLKNLLSQ
AAVNLLSSGSDRDSKKQEEGGDTEKKDIRALIRKQRTAELHLGDFLVFLRRVVSSKAIQS
KMASPKWTEVLLNIAAQKCCSGVPLVGNLRTRLLALHVLEAVLPACETSMDEEQVTRVVE
RLFSLLSDCMWEAPIAQAKHSMQVKERVQELRLQGEAEEEDENLPVQEVSFDPEKAQCCV
VENGQGLTHGSGGKGYGLASTGISSGCYQWKFYIVKENRGNEGTCVGVSRWPVHDFNHRT
TSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKLAFEDV
DATELYPCVMFYSSNPGEKVKICDMQMRGTPRDLLPGDPVCSPMATVLAEATTQLIRILH
RTDHWTHRINKTMIERLHKIKACFRDSAGSSGSGGGQRLKKSRSVQSREEHDAQRESPEA
PARPEEDRARHGRQHGLGELSEHSLRTLCTEVWPVLAIIGGADAGLRVGGRCVHKQTGRH
ATLLGVVKEGSTSAKVQWDEAEITISFPTFWSPSDTPLYNLEPCEPLPFDVVRFRGLTAS
LLLDITYLTSIHEDSVTKLSARRHEKKHRSAATTEPAGNDAKLDGEGQNHSEQKDAGAAP
HAASDLRVSHSLDEVKAHVAANSKSEGEICSVAGGGGNDTIFTSALHAPAEGGRKKGHEH
GYRGHEPSASSAASQSEIHAVQLSYLYLGAMKSLSALLSCSKYAELLLIPKVLPEAAPSG
HNADVSTGAGGGGAATSPVCKEEVEMRAALQFLMRHMVKRAVMRSPIKRALALADLERAQ
AMIYKLVVNGLMEEPSGGKTKPGVRVEADGEADGQEGEQLAQTPITTSPSASSTTSFMSS
SLEDTTTATTPVTDTETVPASESPGVMPLSLLRQMFSSYPTTSLVPTRRAQTPPVSSLPT
SPSDEVGRRQSLTSPDTQANRPQNRSALSDPSSRLSTSPPPPAIAVPLLEMGFSLRQITK
ALEATGARGEADAQNITVLAMWMIEHPGTEDERDEPHGRGGVAADGSDSCTGAAASAGGK
SAERSSFLGSSGDTGTDTSEMEEGFSECPEGLEQESAAASSSAAHRGRHAVGRKPRFDLA
ARTLLARAAGLYRSVQAHHSQTRRDVSSLQQQDPGALYDFNLDEELEMDLDEETMEAMFG
QDLASDSDILGMWIPEVLDWPTWHVCEADDRDEVVVCELCEANVANFNQHMKKSHPGCGR
SANRQGYRSNGSYVDGWFGGECGSGNPYYLLCSCCREKYLAIKSKAKVPVVERYKGQAPD
LLGKQDSVYEEDWDMLDVDEDDKLTGEEEFELLAGPLGLSERKIVPEAVQFPDSDPLGAS
VAMVTATNSMEETLLQIGCQTSVDKSSSGRVTLGEQAAALQSPHDRVMALRRVTAAAQVL
LARTMVMRALSLLSVSGSSCSLAAGLDSLGLTDIRTLVRLMCLAAAGRAGLSTSPTSSSG
HAERPRGSAKASKPISCLAYLSTAVGCLASNSPNAAKLLVQLCTQNLISAATGMNLTTVD
DPIQRKFLPSFLRGVAEENKLITSPNFVVTQALVALLADKGARLKPACDKADVEKRGPLE
LANALAACCLSCRLSSQHRQWAAQQLVRTLAAHDRDNNQSRPQTFADMAGDLRKCSLVKL
EAHQGRVITCAWSSQKGLLATSGSDGTVRVWNVTKNQYTLQQTCIFNKDNGSSDEALSAL
GSPSDPCLSPLAWSLTGKYLACAMEKIVNIWQVNGGKGLLDVQPHWVSALAWPKEEAETL
WCGEPKDLLLVGRMDGSLGLIEVLDSTSMQRTELEHCYRKDVAVVNIAWHSEDKPFTVGY
ADGKVLVGSKKPLENGAIVVIDAHQESITSMKWSPSGRVLLTCAKEETVKLWAAPDSNPG
SGWRCLQSLKHPSLVNGVAWCGLQGRGPRPLSMLAVCCQNGLVSVWTVPQDIADFPESSC
SDPEDWWENESSQCTPDGAACVFQLKGHITPVRTLAFSPDGLALVSGGVGGLMNIWSLRD
GSVLQTAVAGSGAIQNIVWIPDVGVAVCSNRSKDVLVVNCSKDFLASNHVLATCRTALKK
QGIVGLNVAPCMRTFLERLPIMLQEQYAYEKPHVVCGEQLVHSPYMQCLSSLAVGLHLDQ
LLCRPPVPPSLRHCPPESGTAAWCASEWAWLDCFSTTVKAAEALARGGAFPDSFCVPDME
PVAKEDLALLMDNSKWASGLDEQIMSWATSRPEDWHLGGKCDVFLWGAGRHGQLAEAGRN
ILVPTTAPSFSQAQQVVCGQNCTFVIQPNGTVLACGEGSYGRLGQGNSDDLHVLTVISAL
QGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEV
VQMSCGFKHSAVVTADGKLFTFGNGDYGRLGLGNTSNKKLPERVAALEGYQIGQVACGLN
HTLVVSADGMMVWAFGDGDYGKLGLGNSTAKSSPQKVDVLCGISIKKVACGTQFSVALTK
DGRVFTFGQDRLIGLPESRARNHNRPQQLPALSGVHVQDVAVGAEHTLALSSTGDVYAWG
SNSEGQLGLGHTNHVREPTVVTMLQGKHIHQVSAGRCHSAAWTAPSLPPRAPGSSVPLQL
GLPVAVPPQYSCLKEVSVEALRARLRLLYHFSDLMYSSWRLLNLSPNNQSCTSHYNAGTW
GIVQGQLRPLLAPRVYTLPMVRSIGKTMVQGKNYGPQITVKRISTRGRKCKPIFVQIARQ
VVKLNASDLRLPSRAWKVKLVGEGADDAGGVFDDTITEMCQELETGVVDLLIPSPNATAE
VGYNRDRFLLNPSACLDEHMLQFKFLGILMGVAIRTKKPLDLHLAPLVWKQLCCIPLQLE
DLEEVDLLYVQTLKSILHIEDSGITEDNFHEMIPLDSFVGQSADGKMVPIIPGGNSIPLS
FSNRKEYVERAIEYRLHEIDRQVAALREGMSWIVPVPLLSLLTARQLEQMVCGMPEICCD
VLKKVVRYREVDEQHPLVQWFWQTLDEFSNEERVLFMRFVSGRSRLPANTADISQRFQIM
KVDRPYDSLPTSQTCFFQLRLPPYSSQAVMAERLRYAINNCRSIDMDNYMLSRNVDNAEG
SDTDY
Download sequence
Identical sequences H3CCQ0
ENSTNIP00000006023 99883.ENSTNIP00000006023 ENSTNIP00000006023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]