SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006033 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006033
Domain Number 1 Region: 778-900
Classification Level Classification E-value
Superfamily BRCT domain 2.49e-22
Family DNA topoisomerase II binding protein 1, TopBP1 0.087
Further Details:      
 
Domain Number 2 Region: 598-713
Classification Level Classification E-value
Superfamily BRCT domain 7.2e-21
Family DNA ligase 0.015
Further Details:      
 
Domain Number 3 Region: 98-189
Classification Level Classification E-value
Superfamily BRCT domain 2.22e-18
Family DNA-repair protein XRCC1 0.077
Further Details:      
 
Domain Number 4 Region: 540-627
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000556
Family BRCT domain 0.05
Further Details:      
 
Domain Number 5 Region: 10-94
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000497
Family DNA-repair protein XRCC1 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006033   Gene: ENSTNIG00000003446   Transcript: ENSTNIT00000006181
Sequence length 1005
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:59024426:59032030:-1 gene:ENSTNIG00000003446 transcript:ENSTNIT00000006181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEQDNDVPEELFKDVKFYVVGDIDHKVVNLLKAGKGKEVSYNALATHIIAEDGDNPEVG
ESREVFDLPVVKPSWVILSVRCGVLLPVTGFSPESGQVFFGVTACLPRVSWCKQLPEDLN
ALWAYVTFYGGECQLNLNKKVTHLVVKEPKGAKFECALRHPGIKIVTPDWITDSVKDKSR
KDEAHYHPRLTYVEPEEEEEASEAESFDQQSRSDGSYSPRRSRLSSGASSGEESSPRRRP
GPKKLSSISPSSPRKPEHERMFDDSDDDSSTEKEGTNLNWTLAEVPAAPPSLPSGTAKRQ
SGPPGSKVSVSGSGLINLCATVPPVPGSGSAVPPSAAGLSHTAQEGVSVPENISGWSLTN
RTLRNITNNSDMQPVNRPVNTGHIIQNMTANQTKPSEHLNNQSSNQTPNTTNPLLFHQAK
MAAQAGIAEQQQPYQAAQQHQQLPQQPQHPIMHLQQQHPMIQLHHQQQQSQVSQQGFPQL
ISHQQQNAFLLQHQQQTAMQPHLQQPPHITRKYVHLVSLEVNLLHQSTPIYADSLSVPAD
GFLLGCVFAIADYPEQMADKQLLATWKRVIQACGGSVDSTLTGRSTHLLCESQVSNMYVQ
ALREGKRCVTAHWLNTVLKRKKMVPPHRTLHLPFAFPPGAKPCSQHIMSVTGFVDADRDD
LKLMAYLTGARYTGYLCRSNTVLICKEPVGLKYEKAKEWKIPCVNAQWLCDVLLGNFEAL
RQIQHSRYSIYTHSEPLMPNPQLVQNLMAAWKMPVKITPEAMSSFQLLQKQKMSDSNSQP
ANKKARLDETHSPTKKLPPESTPQVMFTGFEPTQAQQYTKWLHALGGEIADSNQKVTHLV
ANKVTRTVKFLTAMSVVKHIVRAEWLEESWRSQRFVDEQSYTLRDAEAEEMFGFSLEESL
KRAKSEPLFKGKYFYLTPGVCPSLSTMKSILESAGGKLLAKQPSYRKIIEHKQNKNLPEI
ILISCDNDLHLCREYFLKNIDVHNAEFILTGVLTQKLSYDSYPLR
Download sequence
Identical sequences H3CCR0
ENSTNIP00000006033 99883.ENSTNIP00000006033 ENSTNIP00000006033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]