SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006035 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000006035
Domain Number - Region: 56-107
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00523
Family Transglutaminase, two C-terminal domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006035   Gene: ENSTNIG00000003448   Transcript: ENSTNIT00000006183
Sequence length 185
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:59037322:59039527:-1 gene:ENSTNIG00000003448 transcript:ENSTNIT00000006183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKDVHVFVLLALLGLSAAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALEVE
LSDDSFPPEDFGIVSGMLNVKWERIAPASNVSHTVVLRPLKAGYFNFTSASVSYVAQEGG
EVVVGFTSAPGQGGILAQREFDRRFSPHYLDWAAFGVMTLPSIGIPLLLWYSSKRKYDSP
KTKKN
Download sequence
Identical sequences H3BX96
ENSTNIP00000000609 ENSTNIP00000006035 99883.ENSTNIP00000006035 ENSTNIP00000000609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]