SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006096 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006096
Domain Number 1 Region: 195-307
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-23
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 379-484
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-21
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 3 Region: 549-612
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000403
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 489-547
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000848
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 136-198
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000351
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 617-676
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000017
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 312-375
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000375
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 8 Region: 29-130
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000017
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006096   Gene: ENSTNIG00000003508   Transcript: ENSTNIT00000006244
Sequence length 762
Comment pep:known_by_projection chromosome:TETRAODON8:16:8887431:8901989:-1 gene:ENSTNIG00000003508 transcript:ENSTNIT00000006244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GENQRRRRSSDEEETTTFITTTTTVESPGRCQLDLGGPEGYVEAPPTSGPASDCSYTVTV
AMGYGVEVQVMKANLLDGDQMTFEDLGGGGGALANETVLMRGLVVRSRSNQIRIRLHSWR
PHPGSVLLRYQAFALSCVFPRRPAHGDVSVSGLHSGAKAFFSCLPGYRLQGLRVLTCRNA
STPYWSGKEPQCLASCGGVISNATVGRIVSPGFPSNYSDNLTCHWLLEAPRGHRLHLHFE
KVALAEDDDRLLIRNGNSAAAAALYDSYQVEYLPNEGLLASSGSLLLEMTTDASGTSTGF
AVRYQAFAAGHCYQPFVKYGNLTSSDATWAVGAVVEFACRPGYTLEQGSITIECVDAANP
QWNETEPACRAVCSGETSESAGVVLSPNWPEAYDRGQDCIWGIHVDEDKRIMLEVQVLNI
GTNDLVTFYDGDDLTAKVLGQYGGSRASFKLYTSTADATIQFQSDPATNVFGYGSGFVVH
FFEVPRNDTCPELPEISSGWRSASRAELVQGAAVTYQCYPGYQLLGPERLVCQWDLSWSG
DLPSCQRVVTCLDPGQVENGRRLLSGPRFTAGSSVQYVCNEGFRLSGNSLLSCLGPGASG
PRWSQKLPRCLPEAWEPCGHPGTPTYGIPSSTRLRFQPGESLRYSCLPGHQLLGEPLLRC
VPGHPSRWSGLPPVCKANPAQTRERGFAAASSADVTMETAQAATFIPVSLLVILVLGIYL
HYTKVQRKSSRLCLSFRSPYQNINQESKPEPSEDTREYEVSI
Download sequence
Identical sequences H3CCX3
ENSTNIP00000006096 ENSTNIP00000006096 99883.ENSTNIP00000006096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]