SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006156 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006156
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.42e-70
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000238
Further Details:      
 
Domain Number 2 Region: 173-296
Classification Level Classification E-value
Superfamily E set domains 1.12e-49
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006156   Gene: ENSTNIG00000003566   Transcript: ENSTNIT00000006304
Sequence length 363
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:60104077:60106185:-1 gene:ENSTNIG00000003566 transcript:ENSTNIT00000006304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFLEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTHPAVKVHNYSGPLRVRISLVT
KNAPYKPHPHELVGKDCKHGYYEADLQERRVHSFPNLGIQCVKKKDVSEAITCRLQTGNN
PFSIPEAKVWEEEFDLNSVRLCFQASFTQASGQRLQLAPVVSQPIYDNRAPNTAELKICR
VNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEAKGTFSQADVHRQVAIVFRTPPYR
HAHLSEPVRVKMQLRRPSDREVSEPVDFQYLPAEPDEYRLTEKRKRTGDVFQSLKLGPLL
STVTLPQERQHLSPRRTGAAKGPAPAAVAAQPAVGLNSAPPPSSAAPPGGGAAKPPPSYA
FGQ
Download sequence
Identical sequences H3CD33
ENSTNIP00000006156 99883.ENSTNIP00000006156 ENSTNIP00000006156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]