SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006163 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006163
Domain Number 1 Region: 198-289
Classification Level Classification E-value
Superfamily Fibronectin type III 7.94e-17
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 70-129
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000108
Family Ankyrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006163   Gene: ENSTNIG00000003573   Transcript: ENSTNIT00000006311
Sequence length 699
Comment pep:known_by_projection chromosome:TETRAODON8:2:2698557:2703183:1 gene:ENSTNIG00000003573 transcript:ENSTNIT00000006311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQKQNLQSTQDRKGTDGPTSPSAAKRLYRNLSEKLRGSTSSFEDTHFFGKMDRLRKSS
CCQTMPSNEVLVEAVEQQDLDAVQILLYQFSAEDLDLNTPDSRGLTPLDIAIMTNNIPIA
KLLLKAGAKESPHFVSVESREAHLDMLVMEAEQRMADLSAQAQRDSLSTEACHMDEGLQT
WEWRTKLYKRMKLGFQHARAPEAPSVVRLSVSSSTTLTVSFQEPPCINASVVTKYRVEWS
CLQDFSLLAGELLLDNLQSLKCTISGLTTGRRYHVRVSAYNMKGWGPPASSCPPSAAPSN
WRQSVGQEPKRRGRIEAMERLLQQVRAAHTHYCCGDVSKPQNPSRKQSVSRSLKHLFNSS
NKFVKTLKRGVYLAAIFYHRESLLVTTEDQIPIVEVDDSYSSSLMHDFLWFTKLSCMWED
VRWLRQTTSVSTSASSTLQIRHKLLTAAGQLQSMLGTHNLGRVHYEPIKDRHGNVLFVTI
RDTESHHSVFSGKWMQVSKLQSQRKSMSTPEEPYALDILIITIQDLMAFHQHSTKQLAPG
LYLGYLKLSSSVDQIRVLVSQQTPNVLCHSRIRDNANVSKEEWDWIQKLSVTCDKEYSET
KEEAGPQTESHAPLLYHELQSAIKTLLKRLHLHLEQARDFRLYSQEVVELAHGVSLLLLL
PAADSVCSAPGQSNLYTPLSGFLHLPLQMFEMGNTHVHA
Download sequence
Identical sequences H3CD40
99883.ENSTNIP00000006163 ENSTNIP00000000971 ENSTNIP00000006163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]