SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006179 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006179
Domain Number 1 Region: 162-271
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-27
Family Cadherin 0.0000548
Further Details:      
 
Domain Number 2 Region: 63-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000314
Family Cadherin 0.0000771
Further Details:      
 
Domain Number 3 Region: 1-79
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000557
Family Cadherin 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006179   Gene: ENSTNIG00000003589   Transcript: ENSTNIT00000006327
Sequence length 331
Comment pep:novel chromosome:TETRAODON8:Un_random:28808113:28816741:-1 gene:ENSTNIG00000003589 transcript:ENSTNIT00000006327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAINPVTGVIRVNAGGLDREKHPTYTLTVQAADMEGNGLTGEAKVLLTITAGNTPASTP
TWVIPDINVAENHRGPHPLRIAQIRSNQDKLWRIHYSISGPGADQPPVNLFTMDKVSGTL
FVTQQLDREQQASYMLKAHAVAEGSGTAEEPMDIIVNVIDQNDNKPVFVKDTFLGKVPEA
SPTNFEVIQVEATDLDEPNSDNSDIRYSILSQEPKLPSDNLFAINPVTGVIRVNAGGLDR
EKHPTYTLTVQAADMEGNGLTGEAKVLLTVTAGNTPASTPSAVSTAKAAALRPSTARSHL
HIHLPTPLMLACANSFTSVGLAVLTHTEPEA
Download sequence
Identical sequences H3CD56
99883.ENSTNIP00000006179 ENSTNIP00000006179 ENSTNIP00000006179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]