SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006181 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006181
Domain Number 1 Region: 452-588
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-26
Family Cadherin 0.00016
Further Details:      
 
Domain Number 2 Region: 708-835
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-23
Family Cadherin 0.00043
Further Details:      
 
Domain Number 3 Region: 299-427
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-20
Family Cadherin 0.00073
Further Details:      
 
Domain Number 4 Region: 209-303
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000196
Family Cadherin 0.0000893
Further Details:      
 
Domain Number 5 Region: 821-919
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000419
Family Cadherin 0.00033
Further Details:      
 
Domain Number 6 Region: 570-643
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000857
Family Cadherin 0.0007
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006181
Domain Number - Region: 672-715
Classification Level Classification E-value
Superfamily Cadherin-like 0.00814
Family Cadherin 0.002
Further Details:      
 
Domain Number - Region: 28-94
Classification Level Classification E-value
Superfamily Cadherin-like 0.0518
Family Cadherin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006181   Gene: ENSTNIG00000003591   Transcript: ENSTNIT00000006329
Sequence length 1101
Comment pep:novel chromosome:TETRAODON8:Un_random:28836094:28861802:-1 gene:ENSTNIG00000003591 transcript:ENSTNIT00000006329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVAGARIWVFLFVAFQVSTLGTPEEQTCVPGFEQNNLILRVSSKHLRQRAPLGKVNFED
CTDRTRFSFSSSDGRVRAQTDGALTVKRPITLHEGVASDLLDSSGCEKIKRILKCLDSAD
TAKAQALETLSRDSNVAPLSGFDFLTPVVGFYCQRCEEFFGDWTSAEDHAAIHCCTCSSA
GMEAQVPVVYFHKSGEGLKRRKRDMVIPPLSVAENYRGPYPHKISQIRSNQDKLWRIHYS
ISGPGADQPPVNLFTMDKVSGTLFVTQQLDREQQASYMFRAYAVAEGSGTAEEPMDIIVN
VIDQNDNKPVFVKDTFLGEVPEASPTNFEVIQVEATDLDEPNSDNSDIRYKILSQEPKLP
SDNLFAINPVTGVIRVNAGGLDREAGMEAQVPVVYFHKSGEGLKRRKREWVIPPISVTEN
YRGPYPHKISQLKAHAVAEGSGTAEDPMDIIVNVIDQNDNKPGFVKDTFLGKVPEASPTN
FEVIQVEATDLDEPNSDNSDIRYKILSQEPKLPSDNLFAINEVTGAIRVNAGGLDREKYP
EYTLEVQAADLEGIGLTGVAKVILTVTDSNDNAPAFTQASYETSVAENKADSQILRMLVT
DGDEPHSAAWNAKFTIVSGDPGGFFSVKTGTNKQEGILSTAKVHFSHRKFGTLMSRLKKI
RTSLLLCCPLPTKGLDFEKNSKHTLLIAVENEVPFAVALPTATATVVVTVQDVNEAPIFD
PPEKQVSKGEDLPVGTDVVQYTASDPDTARKQKVMYRILNDPAGWLNVDKETGVIKVKTS
MDRESLFVKDNKYTALIGAYDNDEVPATGTGTLMVLLEDVNDNAPVIEERAFQVCRNKPA
PQLLSVTDKDGPGNGAPFSVSLQDPSRSNWTARMNDSKTGIILQLTKALESGQYTVVLRV
ADNRGRDQDNTVQATVCECTGEDNQCQERVAAGTNLPVILGVLAGILLLLMLVLLLLMFA
RRRRGPQKEPLLQDTDTRDNIFYYDEEGGGYDLSVLHRGLDNRPEVFRNDVMPNFMPAPQ
YQPRPANPEEIGNFIDNNLKTADNDPTAPPYDSLLVFDYEGGGSDSGSLSSLNSSSSGDQ
DYDCLSQWGPRFKKLADMSQI
Download sequence
Identical sequences H3CD58
ENSTNIP00000006181 99883.ENSTNIP00000006181 ENSTNIP00000006181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]