SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006192 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006192
Domain Number 1 Region: 293-578
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.11e-53
Family Rhodopsin-like 0.0014
Further Details:      
 
Domain Number 2 Region: 2-190
Classification Level Classification E-value
Superfamily L domain-like 8.5e-30
Family Ngr ectodomain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006192   Gene: ENSTNIG00000003601   Transcript: ENSTNIT00000006340
Sequence length 598
Comment pep:known_by_projection chromosome:TETRAODON8:2:6040:15035:1 gene:ENSTNIG00000003601 transcript:ENSTNIT00000006340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSISAFAFAGLPQLADVLLSENGALETIGPGAFSDLPELVELTITKSRHLRYIHPDAFR
DAGKLQYLTICNTGLRIFPDLTKIRSAAHGFVLDLQENSHLQRVPANAFRGLCSQTIREI
RLTRNGIKEVASGAFNGTKMHRLFLRGNQELTSISPQAFAGSSELVVLDVSFTALSALPH
PVLPGLRKLMAESAFQLRELPPPELFARLRQASLTYPSHCCAFHRVRRNRVGAAGSCGDL
LVGHPRWLWPPAGPGGAPCAWSPELRRTATSTGTSAPTPAPSAAVPAQDAFNPCEDIMSS
LFSRVLIWTVSVLALLGNAAVLLVLLGSRSKLTVPRFLMCHLAFSDLCMGVYLVVIATVD
TLTRSRYYNHAIDWQTGLGCSAAGFFTVFASELSVFTLTAITLERWHTITHALQLHRRLR
LRHACALMAAGWLFSGVSALLPTVGVSSYGKVSICLPMDVDSLASQIYVVSLLLLNILAF
FCVCGCYLSIYLTVRKPSSAPAHADTRVAQRMAVLIFTDFICMAPISFFAVSAALKLPLI
TVSHAKLLLVLFYPINSCSNPFLYAFFTRSFRRDFFLLAARFGLFKTRAQIYRTETSS
Download sequence
Identical sequences H3CD69
ENSTNIP00000006192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]