SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006205 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006205
Domain Number 1 Region: 32-213
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.53e-70
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000168
Further Details:      
 
Domain Number 2 Region: 214-316
Classification Level Classification E-value
Superfamily E set domains 3.4e-24
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006205   Gene: ENSTNIG00000003611   Transcript: ENSTNIT00000006353
Sequence length 323
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:33846847:33850799:1 gene:ENSTNIG00000003611 transcript:ENSTNIT00000006353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYLSVPPALAWGRARANAHSPLSNALPPLDWPLPSQFDQYELCIEVQPRPHHRAHYETE
GSRGAVKATPTGHPVVKLCGYTERKPLSLQVFVGTADDRSIRPHPFYQIHRVTGKMVGTA
SHESVQAGTKLLDIPLTPDNNMTVLIDCAGILKLRNSDIELRKGETDVGRKNTRVRLVFR
VHLPLAPPVASSGRVLALQVASLPIECSQRSAQELPVIESISLTSCSVEGGEELLLSGSN
FLPISRVLFTERGTDGKFQWEEEAHVDRDNSNECLLCVRVPTYSDLSITRPVSVSLYVSN
GKRKRSSTHCFKFLPSESFLKRF
Download sequence
Identical sequences H3CD82
ENSTNIP00000006205 ENSTNIP00000006205 99883.ENSTNIP00000006205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]