SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006210 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000006210
Domain Number - Region: 501-544
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00544
Family Spermadhesin, CUB domain 0.0084
Further Details:      
 
Domain Number - Region: 201-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0628
Family Spermadhesin, CUB domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006210   Gene: ENSTNIG00000003616   Transcript: ENSTNIT00000006358
Sequence length 690
Comment pep:known_by_projection chromosome:TETRAODON8:21_random:3130908:3134332:-1 gene:ENSTNIG00000003616 transcript:ENSTNIT00000006358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGRKVSVNPKPDTIIKIDKVNKEPDCSVCTDRGSSQVCNPKQLTLEEATNALVEFTCPQP
QDVFTVEINTKIGEIFRPQSSLFPNFNRTFIWDLGVKPSQAFQLDLPEGGMRQILNGETC
PDEHTYSIVTYLRTGPATIGTFCTGGTITTILVLYKALMTLQVPGHRELDPVDFTLSNGP
ETSTMATVKVSLPRGVSSTGFFAANYPNDFPDKQQVEWDFTVPGMHNYTVHFQAHTAPEC
LNGKVEVEYHKQGKSVTRLALTDPQPEHQQGDFKMVLKNCETNRTLQGLTLDYKVSVMRS
GHPVLCTVDLTKHKDVSLQLLKVGSDPYCEMSVNSKIEEKINVAAGTIASLSFLDCPSQD
VRLTATKTIACQHLGSCPSSLLTVPSLDSCLPIPLHSFTWHMNIPHDSTVDLMSPNGSLH
QSLPGQECSDSLSLHVAESDGLSLGDFCFNGAIQKIQAHTNISVTARVPDFKKSRGPFLH
ASFNQEIQDTFIYRISPEEPQTLLATPNWPQGMKPSSTVSWVVTLPSQYEADLRFFNVSQ
PKCDNSHTSIKVMLLGQEDEILSRREDQPKDYDMLVPESFYLNMSNCIPQEGQFKAMAKI
VLQKKSNLLPIILGVAGAFLLLLIILAVVCVLKKKKKSEKANKNSSIYMGKASIFRPDEI
RFKSRSDNNSHIYDSIDETMVYGHLLPDSS
Download sequence
Identical sequences H3CD87
99883.ENSTNIP00000006210 ENSTNIP00000006210 ENSTNIP00000006210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]