SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006220 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000006220
Domain Number - Region: 327-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family Laminin-type module 0.0018
Further Details:      
 
Domain Number - Region: 3-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000142
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 736-837,892-925
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0023
Family BAR domain 0.073
Further Details:      
 
Domain Number - Region: 508-598
Classification Level Classification E-value
Superfamily Tropomyosin 0.0111
Family Tropomyosin 0.011
Further Details:      
 
Domain Number - Region: 438-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family Laminin-type module 0.053
Further Details:      
 
Domain Number - Region: 653-753
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0165
Family Myosin rod fragments 0.014
Further Details:      
 
Domain Number - Region: 246-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0268
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006220   Gene: ENSTNIG00000003625   Transcript: ENSTNIT00000006368
Sequence length 1044
Comment pep:novel chromosome:TETRAODON8:15_random:82148:88820:1 gene:ENSTNIG00000003625 transcript:ENSTNIT00000006368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPCGCHPVGSVSSTCDSRGRCSCKDGVMGQKCDRCSDGPIGPNGCTQSAPLPCFCHGHSS
RCSAGSGYSVHPITSTFTDGPEGWGTAGVRDTGPTGVLFRWSPKHQDLEVISTSSLPAYL
KAPGPYLGNQLLSYGQNLSFSLRMDHSVRQPSYNDVILEGGGLQVAASLGGLLSAAPCRQ
KMNYTFRLDEQPSSGWRPQLSSQQFQTLLQNLTSLRIRATFGPGRGYLDNVQMVSARRGD
GSPAPWVRTCSCPLGHEGDFCERCSARFKRTNPAEGPFSSCEPCGCRGGGCDPQTGDCYS
ADETAAQLKCPPGFYRNRWDPESCLRCPCPGGVSCTLQDGSGQPQCDPCPLGTTGRRCDV
CQEGFYGDPVGNRACRGNTPPLPPFCSVGCSGFVQSQQPGESPAVGQRSTPPLAGTKMVQ
VEAEKKGAGTTDEKGAACDCDPRGSVSTRCDHLGRCQCKPGFQGVRCQSSSCPACFTSIK
MKMKEYTTKLEEMLLDVGRGHDGVESPEMEAALRNMEQLMDNVQLDMDKSTGLETRLQDR
LSSANTTHVSNRETIQKIAEVQDDAQQRHQLYNRKVDEVQKLLEEMKQNLERAENELRSA
DVPSGDAPQASGFSALLQTALTLADLHQREADVVHQSSSAALNGSMKSLALVQTLMSKEN
KVKDVVGGLRSRHDQTSAQVKDLENQAQHLSSEAREESAAANSMLTDIAKLEQELPSDLK
DDVDTMTSMLSDLAEAATRSSEDLDSLQQGVKQNKAAMENLLKEGRASGQTLEKLLGRVE
AAREVTNAALQGFQGSSEDLNAALTSLKGFNQQINNYRAEADGAVRRLDAINATVQQAAS
SNAETQAVLRDMSEDFRRGLANANTLENLLSSAEGAFRSLPAHSHLLAEGTELKEDSEAL
KIRVDRAAEDLQTEMDAATRLEDDSGQAAVAAAGALDHSRRSRAAVEQTLQQINGLLAQM
NQTGLVDQGRLQQMEHLLASAEREVEQRLRPWLREAELQEDAHKRHLSAVTADMDAVLAD
IDNLKDILASVPEGCFNTLPIEKP
Download sequence
Identical sequences H3CD97
ENSTNIP00000006220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]