SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006226 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006226
Domain Number 1 Region: 42-217,297-456
Classification Level Classification E-value
Superfamily L domain-like 3.65e-62
Family Ngr ectodomain-like 0.0052
Further Details:      
 
Domain Number 2 Region: 551-692
Classification Level Classification E-value
Superfamily L domain-like 1.63e-36
Family Ngr ectodomain-like 0.00073
Further Details:      
 
Domain Number 3 Region: 489-659,741-880
Classification Level Classification E-value
Superfamily L domain-like 3.4e-33
Family Ngr ectodomain-like 0.00058
Further Details:      
 
Domain Number 4 Region: 1142-1295
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.72e-26
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 5 Region: 1074-1114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000118
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 961-1006
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000485
Family EGF-type module 0.006
Further Details:      
 
Domain Number 7 Region: 921-961
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000513
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 8 Region: 999-1039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 9 Region: 1293-1331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000406
Family EGF-type module 0.024
Further Details:      
 
Domain Number 10 Region: 1338-1381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000146
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006226
Domain Number - Region: 1385-1421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000258
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 1121-1151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0324
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006226   Gene: ENSTNIG00000003631   Transcript: ENSTNIT00000006374
Sequence length 1499
Comment pep:known_by_projection chromosome:TETRAODON8:18:11062842:11076795:1 gene:ENSTNIG00000003631 transcript:ENSTNIT00000006374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGGGSSAAGCLPRVQLAWAAALLLVPWGGGVEACPSPCSCLGATVDCHGRGIHAVPKNIP
RATERLDLNGNNLTVISRTDFAGLRHLRVLHLMENQIVAVERGAFDELKELERLRLNRNR
LGQIPELLFQKNEALTRLDLSENVLQAIPRRTFRGATELKNLQLDKNHISCIEEGAFRAL
RTLEVLTLNNNNISSIPVSSFNHMPKLRTFRLHSNSLRCDCHLALSPWLRQRASLGLYAQ
CSSPPSLRGLNLAELRKSDLACSGHGGSAFVQPCSLASGSCPPMCTCSNNIVDCRGRGLT
AIPAHLPEAMTEIRLEQNGIKSVPPGAFSSYKKLRRIDLSNNQIAEMAPDAFQGLRALSS
LVLYGNKIAELPAGVFDGLSSLELLLLNANRIHCIRASLFKDLENLALLSLYDNRIQSLA
KGTFGSLRSIQTLHLAQNPFVCDCHVRWLAEFLRANPIETSGARCASPRRLANKRIAQKS
SKFRCSEKSPAYNNPRSSTSSQANRLCPANVVDCDNQRLTLFQPPPDQLPPTPASQRLNN
NDLSVLEATGAFKGLSQLKKINLSNNKISEIEDGAFEGAASVVELHLTANHLDAVRGSMF
KGMEGLRMLMLRNNKISCLHNGSFTGLNNVRLLSLYDNQLSTILPGAFDTLPNLSTLNLL
ANPFNCDCRLSWFGAWLRSRRIVTGNPRCQSPAFLREIPLQDVAAPDFRCEDGAAQEEAG
CGLGPQCPSQCTCMDSVVRCSNKHLQALPRGLPRNVTELYLDGNQFTSVPKELATFRFLQ
LVDLSNNKISFLSDDSFSNMSQLTTLWRLQTLSAASPLLALSGLRSLQIWLSLHGNDISE
LTDRASYSRRAPSLSHSVRAIGANPLYCDCRLLWLSDWVKSGYKEPGIARCAGPGGVEGK
LLLTAPAHSFQCDGPVEPSVRAKCSPCVSSPCQNQGVCKDDHTQLFTCTCKPGFTGKHCE
TPVDACVSNPCTNGGVCLSDEQTGGFRCACAFGFHGTFCEVNVDDCQDHGCENGATCVDG
VGNYTCLCAPSYKGLFCEEVDSVCGPGRNPCQHQSTCISTPAGPRFPGWVGPECSIDYNE
CVDHRCQNGAECVDHLDGYSCVCPQGFSGQFCEAPPPPASPCQLAQCQNGALCVEAAGAA
ACTCAPGFEGQRCEKLVSVNFLERDSYVQLQDVKNWPHANITLQVSTAEDNGVLLYNGDN
EPIAVELHQGHVRVTYDPGDQPATSIYTLEGRGRSQAAAGEAPLYVGGLPEEAVPAAPDA
VNVSGFHGCIRKLYINHELQDFTRSHMGAGVEPGCQACRQSYCAHGTCQPDAAQGPRCHC
HPGWAGPRCDRPATAEGVTVATGVDPCADSRCVQGACVPVDARTYRCDCRDGYEGALCHL
QRQPASWCGRLPCVHGQCERTEKAERCACEDGFSGQSCDIELPCGGQPVRDHHRLRRGSA
LCQTAKPFSWVECRGRCGVATCCAPLRLRRRRLSFQCDDGTTFTQDVEKPVECGCKECV
Download sequence
Identical sequences H3CDA3
ENSTNIP00000006226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]