SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006242 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006242
Domain Number 1 Region: 616-728
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.19e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00051
Further Details:      
 
Domain Number 2 Region: 64-233
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.97e-32
Family G proteins 0.000002
Further Details:      
 
Domain Number 3 Region: 339-405,556-601
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000001
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 4 Region: 745-831
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000042
Family Ankyrin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006242   Gene: ENSTNIG00000003647   Transcript: ENSTNIT00000006390
Sequence length 863
Comment pep:known_by_projection chromosome:TETRAODON8:3:1341202:1400636:-1 gene:ENSTNIG00000003647 transcript:ENSTNIT00000006390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LANSAAIRAEIQRFESVHPNIYSIYELLEQVDEPQLQNQIREHVIAIEADAFVNSQEWTL
SRTVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSHLLLIRDE
GGPPEAQQFALWVDAVIFVFSLEDENSFQTVYHYFNRLASYRNPADLPLVLVGTQDAITS
ANPRVIEDSRARKLSNELKRCTYYETCATYGLNVERVFQDVAQKIVANKKKQQLSIGPCK
SLPNSPSHSSVCAAQVSAVHISQTSNGGGSLSDYSSSVPSTPSTSQKELRIDVPQTTNTP
TPVRKQSKRRSNLFTSRKASETDKEKKGLEARADSIGSGRAIPIKQGMLLKRSGKSLNKE
WKKKYVTLCDNGLLTYHPSLLMHQISVKAHHFNLSESSARVRVSGGLAQRAPGSRALWWL
VKPPSRALGFELAFCQLSCQKEAEQPTSPVLVKADKRFRAGNGGSLLRNDGQLRLNDCKI
SYGRPWGCLPSWGRAGRLPACIRLLPAHAPSISSTTSPKMEPPPSPHANRKKHRRKKSTS
NFKADGLSGTAEEQEENFEFTIVSLTGQTWHFEATSYEERDAWVQVIESQILASLQSCES
SKNKSRLTSQTEAMALQTIRSIRGNGRCADCDAQNPDWASLNLGALICIECSGIHRNLGT
HLSRVRSLDLDEWPLELIKVMTAIGNELANSVWEANAQGRPKPAPDASREERERWIRAKY
EQRLFLAPPPSSDLSLGQQLLRSTAEEDLRAVVLLLAHGNRQQVNETCGEADGRNALHLA
CRKGNVVITQLLIWYGVDLLARDVHGNSAIAYARQASSQECVDTLAQYGCPDERYPLMAT
PNLSRRNTNRNNSCSSIGSAALI
Download sequence
Identical sequences H3CDB9
ENSTNIP00000006242 ENSTNIP00000006242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]