SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006272 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006272
Domain Number 1 Region: 298-427,696-873
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1e-50
Family Diacylglycerol kinase-like 0.014
Further Details:      
 
Domain Number 2 Region: 29-153
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-29
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 3 Region: 201-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000254
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000959
Further Details:      
 
Domain Number 4 Region: 139-195
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000613
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006272   Gene: ENSTNIG00000003675   Transcript: ENSTNIT00000006421
Sequence length 1069
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:60810722:60822829:1 gene:ENSTNIG00000003675 transcript:ENSTNIT00000006421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EESSDSDGEQEETSHKLIRKVSTSGQIRAKKSVKEGILLKQTSSFQRWKRRYFKLRGRTL
YYAKDCKSLIFDEVDLSDASVAETSTKNINNSFTVITPFRKLMLCAESRKEMEDWIGALR
SVQKWETYEASQFNMEHFSGMHNWYACSHARPTFCNVCREALPGVTSHGLSCEVCKFKAH
KRCAVRSTNNCKWTTLASIGGDIMEDEDGVFMPHQWLEGNLPVSARCVVCDRNCGSVRRL
QDWRCLWCKAIVHSSCKDQTGKVCPLGQCRVSIIPPTALNSIDSDGASGKATSGSCSSPL
LVLVNSKSGDNQGVKFLRKFKQLLNPAQVFDLMNGGPELGLRLFQKFVTFRILVCGGDGS
VGWVLSELDKLRLHKQQCQLGVLPLGTGNDLARVLGWGGLCDDDAQLLQILEKLERATTK
MLDRWSVMTYEVPSTGAPAREEEGPDSPLQVHISQYADSVASHLAKILDSDQHSDVISSA
KFLCGTVNEFVAEVGKAYERATENREEADAMARKCALLNEKLDSLVKALSEEAEAQTASV
SLASSLSCRWCRPARCPAREAKAYRSKEQLMLRANSLKKALRQIIEQAEKVVDEQNRHTQ
VHRMSSSSSIRRENSEELKEAEPRECDLGGGPLTCGCCRCGQPEPRLPHRPGEIRGPRRR
HLQRGVCVSPPPPTAAVVPATLRPHTPGRLRRLCWEKCVMNNYFGIGLDAKISLEFNNKR
DEHPRKCSSRTKNMMWYGVLGTKELVQKTYKNLEQRVQLECDGVAVPLPSLQGLAVLNIP
SYAGGINFWGGTKEDNNFGAPSFDDRKLEVVAVFGSMQMAVSRVINLQHHRIAQCRQVKI
TILGEEGVPVQVDGEAWVQPPGIVRIVHKNRAQMLTRDRAFESTLKSWEDKRKGESYRAS
RPRLNSQQSMEYLTEEECAQAQQLGLVADTLINRIREVAKSHKLVEQELAHAVNATALVL
TEAKLSSPEGLSRSTAVEIVNSSKVLQAETRMLLDGKLLAESPEEAELGLTLSNLSAELL
KLEDIHWICPLMQGPEEESARSGKSSVKLKIIPKVKKEKLHKQKSNSSL
Download sequence
Identical sequences H3CDE9
ENSTNIP00000006272 99883.ENSTNIP00000006272 ENSTNIP00000006272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]