SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006279 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006279
Domain Number 1 Region: 12-119
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-23
Family C-type lectin domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006279   Gene: ENSTNIG00000003682   Transcript: ENSTNIT00000006428
Sequence length 197
Comment pep:novel chromosome:TETRAODON8:Un_random:60858921:60860316:-1 gene:ENSTNIG00000003682 transcript:ENSTNIT00000006428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAASSADISRRFYLEERSMNWSDAQAFCRRRYADLAWVRNKQENQALRDVSRNGTAWI
GLSKQSWRWSDRSQATFLPWKTPAPPQGDCGALDVRGETPAITQANCAGNASFLCSRGPL
RKRWLSLKLVADGSFTRDQAVTQSLLNLIKLRLTEVGLSENVILSWWKRPEKEKKAEQTT
QEHKMCLFNDSYVPFLA
Download sequence
Identical sequences H3CDF6
ENSTNIP00000006279 99883.ENSTNIP00000006279 ENSTNIP00000006279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]