SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006306 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006306
Domain Number 1 Region: 513-784
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.5e-50
Family Tandem AAA-ATPase domain 0.078
Further Details:      
 
Domain Number 2 Region: 113-260
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.8e-30
Family Tandem AAA-ATPase domain 0.056
Further Details:      
 
Domain Number 3 Region: 394-469
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000819
Family Ankyrin repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006306   Gene: ENSTNIG00000003707   Transcript: ENSTNIT00000006455
Sequence length 1330
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:37162471:37171681:-1 gene:ENSTNIG00000003707 transcript:ENSTNIT00000006455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFRKGSNRFLTVTKKDGSDKPQHSMLLSPSHNSLFVIHNLLERFPVSNKERLEMQPSSRS
ASSLVSEADSALDKNRASGRLNKGIPVVPPQRSPSELDVFRCSLPVQEHKQEILQLIREN
RAVLVVGATGSGKTTQIPQFLLDECHKKREPCRIFCTQPRRLATITVADRVAAERGENVG
KTVGYHIRLESRVSPKTVLTFCTSGVFLRTLMAGDASLSTVTHVIVDEVHERDGLTDFLL
TKLREVLQKFPSLKLILSSAALDADLFRQYFGSCPVIHLKGRLFEVKELFLEDVLKLTGF
RSKEVLKHDEVAQKGEKKRKSLTEWCETVKRSSAEEEEGSGGLPGDGAVLDREDGSFGSP
DEGGPGQLEPWLVKEMDSCISSIFLNEDQDAFIQLFNLILYENVNVNYRHSETGTTALMV
TAGQGFLPQMEQLLHMGADVGIKASNGWTAVDFAKHFHQNESMELLKSFLISREVCRPGG
PAVDQQVTAESGDKDEELLKLYHQSFDDELVDLDLIMDLLHYICSTSSDGAVLIFLPGYD
EIVSIRDRILYNDNRFSLQSERYQLFILHSEMQTQDQKKALKNPPAGVRKIILSTNIAET
SITISDVVFVIDSGKGQKKSFDTLSRVSMLKTVWISKASALQRKGRAGRCKPGCCFHLFS
RLRFDNMLEFQVPQLLRMPLQELCLQTKLLAPPSCQVAEFLSKAPQPPPAHAIKNALQML
KSIDAMEQHEDLTDLGFHLADLPVEPHLGKMVLCAVALKCLDPILTIACTLAYRDPFTLP
AEGSKKKAALHCRKHFASSSFSDHMALLRAFQAWQKARSDGWERAFCEKYFLSQATMNMI
FGMRTQLLGQLRAIGFVRAHGGSDIRDVNLNSENWAVVKAALVAGMYPNLAHIDQETALL
SSSRKKKLHFHPTSVLNPAHLKEVGRPQSSPAQSPQNYPTEWLVYDEMSRGHRMVVTRCC
SLVTPITAAIFAGCAKLPFPALEQPAEHRATGTQLDGTSDSEQRHRPAGRLRDQRLSGWL
TCVCCCQAARLVYELRQKWQNLFLKRMRFPSKPWSQQDEAIIHAVVSVLAAEEHAAGLQQ
PAGIGQRPRPMAVEEDRSSPKSTAHLPAAAPSCSPLQDKTKPQELLPTRAMQRSMKAGGQ
SEDRGELVCVAGQSQGKDEDQSFSSGLGRGPQPRARSSGGQGAEKRPPRPSARLRSQTNQ
VGSIKISQQKGIWSTTTSNESKLSKAFVEDHLVILIFSVQGSGHFQGYARMTSVISQESC
QDWDVLGLGGVFSVEWLQKESIPFHCTQHILNPWNDSKKVQISRDGQELEPQAAAQLLAL
WDRRAGRPAE
Download sequence
Identical sequences H3CDI3
ENSTNIP00000006306 99883.ENSTNIP00000006306 ENSTNIP00000006306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]