SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006312 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006312
Domain Number 1 Region: 44-796
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.44e-276
Family Motor proteins 0.000000000153
Further Details:      
 
Domain Number 2 Region: 1988-2104
Classification Level Classification E-value
Superfamily Second domain of FERM 8.5e-23
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 3 Region: 2105-2195
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-20
Family Third domain of FERM 0.017
Further Details:      
 
Domain Number 4 Region: 1256-1359
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.24e-20
Family First domain of FERM 0.036
Further Details:      
 
Domain Number 5 Region: 1351-1446
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000209
Family Second domain of FERM 0.0082
Further Details:      
 
Domain Number 6 Region: 1888-1996
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000062
Family Ubiquitin-related 0.095
Further Details:      
 
Domain Number 7 Region: 1617-1666
Classification Level Classification E-value
Superfamily SH3-domain 0.000000715
Family SH3-domain 0.0042
Further Details:      
 
Domain Number 8 Region: 795-864
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000085
Family Motor proteins 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006312
Domain Number - Region: 829-952
Classification Level Classification E-value
Superfamily Lipase chaperone-like 0.00955
Family Lipase chaperone LifO-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006312   Gene: ENSTNIG00000003713   Transcript: ENSTNIT00000006461
Sequence length 2209
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:27742066:27757757:1 gene:ENSTNIG00000003713 transcript:ENSTNIT00000006461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIVQQGDYVWLDLKTGREFDVPVGAIVKLCDSGQIQVADDEGREHWISPQNATNIKPMH
PTSIHGVEDMIRLGDLNEAGILRNLLIRYNEHSIYTYTGSILVAVNPYQLLPIYAADQIR
LYTNRKIGELPPHIFAIADNCYCNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISG
QHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGARIEQYLLEKS
RVCRQAPDERNYHIFYCMLRGMSPEMKGKLGLGLARDYSYLTMGRCTACDGRDDLGDYSS
IQSAMKVLMFTETESWEISKLLAAILHMGNLRFQARTFDNLDACMVVRSPDLVTAAALIE
VEPKDVMLCLTTRTLITRGESVVTPLSVGQGLDVRDAFVKGIYGRLFVWIVDKINAAIYR
PPSSESTVLRRSIGLLDIFGFENFIVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLE
DINWQHIEFTDNQDALDMIALKPMNIISLIDEESKFPKGSDATMLYKLNSQHKLNSNYIP
PKNNHETQFGIQHFAGVVYYETRGFLEKNRDSLHMDIIQLVHSSKNKFIKQIFQADVAMG
VETRKRSPTLSSQFKRSLEMLMRTLSVCQPFFVRCIKPNELKKPMSFDRELCIRQLRYSG
MMETIRIRRAGYPIRYTFVEFVERYRVLMPGIKPAHIQEDLRGTCQQIVLARLGKHDDWQ
IGKTKIFLKDHHDTQLEIERDEAITDKVILIQKSIRGHRQRLNFLRLRTSATTIQRFWRG
HRCRRNYRTMKTGFLRLQAIFRSRKFFISYQATRLRVTLIQARCRGFLVRQMFWRHLRAV
LTLQAYTRGMIARRLCHRLRAERHQRQEAERQRLAEEERLLAQMTAQRAKAEADRKHQER
LDQLAQQQEEREREEREEARRKKELLEQMERDKEQPVDHSDMVDQVFGFLGNTGPLPNRE
GQAPAGFEDLEKTPRWDECEEEVLSEAPPLPHDEHEDLSEYKFFKFAATYFQGVSTHTYI
RRPLKQPLLFHEDEGDQLAALAVWITILRFMGDLAEPKCQMVINDGSEKIPVMTKIYETL
GKRTYKRELQELQVEAEEQNSSSENQKRSSVRHKLVSLTLKRKSKITEEVTRRLTEGDHR
MEGNSMLEERPTSNLEKLHFIIGNGILRPTLRDEIYCQICKQLTQNPSKSSHARGWILLS
LCVGCFAPSEKFVKYLRTFLNNGPPGYAPYCEERLRRTFVNRTRTQPPSWLELQATKSKK
PIILPVTFMDGTTKTLLADSATTASELCNALADKINLRDRFGFSLYIALFDKVSSLGSGS
DHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFSPWHDPADDDVATNLIYQQIVRGVK
FGEYRCEREEDLAELASQQYYVDYGSDILLERLLGLVPTYIPDREISSTKTAEKWMQLIA
SAHKKGVHTKRRLDPHKVKEDVVDFARLKWPLLFSRFYEAFKFSDTGPSLPKNDVIVAVN
WTGVYFVDEQEQVLLELSFPEITAVSSSRCVNTPTGSIRLIETSPSFYFPFARGGKLQGQ
SFTLATIKGDEYTFTSNNAEDIRDLVVTFLDGLRKRSKFVVGLLDCANPAGVDSTFLSFS
KGDLIILDEHDGEHVMNSGWAHGINDRTKLKGDFPADCVYILPTITRPQYELVALVTMTP
DQRRESMGLSTSDLADEEEKLKAYTLEEFSYDHFRPPPKNTLSRVMISKSRGKERLWSCT
REPIKQPLLKKVLAHEELTQEACVAFMPTVPVMKYMGDYPIQACAINELTDQIFEGALKA
EPLKDEIFCQILKQLTDNNIKYSEERGWELLWLCTGLFPPSNVLLPHMQKFLQAKKHHPL
AADCMQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDSDKVFEVESSTKAKD
FCHNISALLIRSSEGFSLFVKITDKVISVPDGDFFFDFVRHLTDWIKKARHVKEVGAGPS
LTYQVFFMKKLWTNTVPGKDSMADSIFHYYQELPKYLRGYHKCPREEVNQLAALIYRAKF
EDDKSHFQNTSKILKELVPQDQIRNLSPDDWRRSIMSLFNKHSGTSREEAKLSFLKIIYK
WPTFGSAFFEVKQTTDPNYPESLVIAINKHGVSLIDPRSKDILITHPFTKISNWSSGNTY
FHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTTMTKQRSSRGNS
Download sequence
Identical sequences H3CDI9
ENSTNIP00000006312 99883.ENSTNIP00000006312 ENSTNIP00000006312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]