SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006323 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006323
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.53e-24
Family Ubiquitin-related 0.000038
Further Details:      
 
Domain Number 2 Region: 226-290
Classification Level Classification E-value
Superfamily XPC-binding domain 1.09e-21
Family XPC-binding domain 0.0000708
Further Details:      
 
Domain Number 3 Region: 143-198
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000608
Family UBA domain 0.0003
Further Details:      
 
Domain Number 4 Region: 303-351
Classification Level Classification E-value
Superfamily UBA-like 0.000000000014
Family UBA domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006323   Gene: ENSTNIG00000003723   Transcript: ENSTNIT00000006472
Sequence length 354
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:61172274:61175763:-1 gene:ENSTNIG00000003723 transcript:ENSTNIT00000006472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMQITLKTLQQQTIQIEIDPEQTVKALKEKIEAERGKDNFPVSGQKLIYAGKILQDDTPI
KEYKIDERNFVVVMVSKAKPTTAATAPASEPPKAPLQDSGATSTAAPVSPAAIPIPVPSE
EAREEPSAAVTEPQQPASSSDGSQGLDASSALVTGAEYEAMLTEIISMGYERERVVAALR
ASFNNPHRAVEYLLTGIPSSPVQESNPPAQAPAPLPTESPASPAEGENPLAFLRNQPQFL
HMRQAIQQNPNLLSALLQQLGQENPQLLQQINQHQERFIQMLNEPVGEGGELGAAGEEGS
SVNYIQVTPQEKEAIERFKALGFPEALVIQAYFACEKNENLAANFLLNQGLEDD
Download sequence
Identical sequences H3CDK0
99883.ENSTNIP00000006323 ENSTNIP00000006323 ENSTNIP00000006323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]