SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006363 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006363
Domain Number 1 Region: 74-476
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.22e-82
Family Regulator of chromosome condensation RCC1 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006363   Gene: ENSTNIG00000003763   Transcript: ENSTNIT00000006512
Sequence length 495
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:61897912:61901885:1 gene:ENSTNIG00000003763 transcript:ENSTNIT00000006512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKVTAVSGNGGMKKKKISGKRKERDFSSDDEFDFEQENNKKAGKPCAKSAPQPVTVA
EDVKEKIKLECPNVKGQLLVFGATNWDLIGRKEVPKQQAAFRNLGQNLWGPHRYGCLNDV
QVSCVVSGPCAAHSLLITAEGKLWSWGRNDKGQLGHGDTKRLEAPKLIEGLADHLVVAAA
CGRNHTLALTDDGSVYSFGENKLGQLGQGSQTYAVLSPALISYDGQPLVKVACGAEFSMV
VDCKGNLYSFGCPEYGQLGHNSDGKFIARAQRIEFDCEIIPRRIAIFIEKSKDGQVMPVP
NVVVRDVACGAQPHELVLDSQKRVFSWGFGGYGRLGHAEQKDEMVPRLIKLFDFPGRGAS
QIYTGYQCSFAVSENGGLFFWGVTNTSRESTMYPKVVPDLCGWKIRSLACGKSSIIIAAD
ESTITWGPSPTCGELGYGDNKPKSSTTAQEVKTLDGVYVEKVMMGYSHSLVIARQDTEQE
KERLKKLPEYNPRTI
Download sequence
Identical sequences H3CDP0
ENSTNIP00000006363 ENSTNIP00000006363 99883.ENSTNIP00000006363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]