SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006368 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006368
Domain Number 1 Region: 146-344
Classification Level Classification E-value
Superfamily E set domains 1.21e-68
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000799
Further Details:      
 
Domain Number 2 Region: 41-161
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.81e-19
Family Voltage-gated potassium channels 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006368   Gene: ENSTNIG00000003768   Transcript: ENSTNIT00000006517
Sequence length 382
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:27789684:27790832:1 gene:ENSTNIG00000003768 transcript:ENSTNIT00000006517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQLLQRHIQPAGQQSRTTRLVTKDGHCNIEFGNIEYSNHFAYLLDFWTTFVEIRWRFVL
LFFVASFTGSWFFFSLLWYWIAKSNGDLTGQNRTDEHVRCVDNVNGLTTAFLYSLETQTT
IGYGGRALTGHCAGTVALIIVQSLIGVFINCFMCGVILAKISLPKKRAKTVTFSDQAVIC
LKEGSLCLLIRVANLRKTLLIGSQIYGKLLRTTSTADGETIILEQVDIDFMVDAGKDHLF
FVCPLTLYHVINRSSPFYELSADSLPHQDFELVVFLEGTAESTSSACQVRTSYIPQEIQW
GYTFLPIISCIQTGKYRVDFSNFSKSVRVSTPHCVHCCEADSDQRNHNGHDTDNHHVHGK
VGIDNLGFQVVDIQESVAITKM
Download sequence
Identical sequences H3CDP5
ENSTNIP00000006368 99883.ENSTNIP00000006368 ENSTNIP00000006368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]