SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006380 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006380
Domain Number 1 Region: 1323-1601
Classification Level Classification E-value
Superfamily VPS9 domain 8.24e-41
Family VPS9 domain 0.0027
Further Details:      
 
Domain Number 2 Region: 14-201
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.79e-35
Family Regulator of chromosome condensation RCC1 0.0049
Further Details:      
 
Domain Number 3 Region: 471-577
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.79e-26
Family Regulator of chromosome condensation RCC1 0.028
Further Details:      
 
Domain Number 4 Region: 995-1084
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.57e-21
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0074
Further Details:      
 
Domain Number 5 Region: 1095-1197
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.83e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.011
Further Details:      
 
Domain Number 6 Region: 861-962
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000617
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 7 Region: 648-849
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000236
Family DBL homology domain (DH-domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006380   Gene: ENSTNIG00000003780   Transcript: ENSTNIT00000006529
Sequence length 1604
Comment pep:known_by_projection chromosome:TETRAODON8:2:16687915:16698827:-1 gene:ENSTNIG00000003780 transcript:ENSTNIT00000006529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRGLFLIWRSAGPSVQLCPERVLLSIPVVQAALGEHHGVLLVQGGLVYTFGELFWKGLSV
PASAPVLEGSLLGKMVVRVAAGGFHCGAVSEQGHVYTWGENTGGQCGLTERGTVSEPSPV
SVVDHDVTPPAAVRVADLAFGREHSLALSAQNELWAWGSGCQLGLVTTAFPVCRPQKVEH
LAGRHVIQVVCGAYHSLALVRSLPPNSHNSQKPSDQTERSHSPLCLEREEAFGGDGGHYC
PLGVELTEGMAAEHSQTSSRRRCPRRRLNPGGRSAGSSPGSAAGALNEDGKTHAKEKSAF
PDESQLQYLLQKLSSHSLERLQVAKDTESVSTLNSLSFFSTHSHLSSRIVCACCLIPSAD
LSVSAAAFTICRISNYDVGGTLPCSSSSLCLDEVRLCLESGLQVQPGKKLSSLSSQTYKA
KSAGSRRHSVPGTPTRGSPRRQRANANLKSSGGQTQAAAPEEEDDGLPSLDTEVWSWGRG
SEGQLGHGDQLASRLQPLCIKALSGEEVVQVAAGSHHSLALTATCQVYSWGSNMCGQLGH
VSTSFIVPHQAKLSDGLRVWGVSAGQNHSLLLADGDCVQPVLLYCGQQKEAPTEEVGTSP
TDSRRGAIRVTPSIHFPVKMGYVSSVRSGGQSCAVLADQNVMGFISAIHELGSRERLFYC
WMCRVRKLLLTPTRSKENASPSLGEPCSRLFSSLCERFSHLSVLIGRHSTSLTYFLQNAQ
GRDVASLPLLTHMEHFVELYKEYCSSVGDFQVMGGFQALQKLTLECLQPTVLAQLSVSDQ
AAGEDNGLESLLYWPLQQLHHYSRVLLKLASCFDVLTAEFQSLHQGCGHYESLSLSLSRM
KKEAESTFLFWKSHSGKSTESLRLPQRRVVCESSSRRSLTLQNAGRFSNHGFILFNDALV
HTQFSTHHVYPLTCLWVKPVAEDSSGLFAIRIICPEESFTIVASTPQEKNKWLRSINRAL
DQVLGGSGEGSSPGTTGMSRTASYTFTAEGRFKDAKYNGGWMSGRLHGRGTLRWPDGRSY
CGNFRNGLEDGYGECVMPNKELNKTDSYHGHWRDGKIHGFGKYKYASGEVYEGCFSDGQR
HGYGMLSSGKLGKETSSVFIGCWVHDKKTGYGVYDDISRGEKYMGMWVEEKRHGSGVVVT
QQGVYYEGTFRDNKMSGPGLLMSEDDTALQAEFSDDWVVSGRGVLLLPNGDWLEGVFSGE
WPSGLKVDGTYTKPFVDEPVNKERTNMFRLGQYVVPAGQRWLCVFAECWSRLGCDAAGRG
DGSTAWENIAVSITAARRQSLCSPDLSRSQNKLLESLEFIPQQPVTTSTYDSVRRYLIKA
CDTPLHPLGWLVETLVTVYRMTYVGVEANRRLLSQAVQELQADLTRFYNIVQFLFPGMPD
DGAVIPDPPESPSGVQSTSGQEDTQILSPRPSLCTVVVSCSSLLLPLLLPRLYPALFNLY
RLQEEQADAQYWERILRLNKQPDKSLLSFLGVQEKFWPVWTSILGEKKQILSSSKDACFI
SAVETLQQISTTFTPSDKLVVIQKTFEELTQEVNPLLDDRFLWCMDDLLPLFIYVVVRAG
IRNLGAEINMIEDLMDPNVQHGELGLMFTTLKACYIQIQQESAT
Download sequence
Identical sequences H3CDQ7
ENSTNIP00000006380 99883.ENSTNIP00000006380 ENSTNIP00000006380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]