SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006435 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006435
Domain Number 1 Region: 787-1058
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000496
Further Details:      
 
Domain Number 2 Region: 1055-1354
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.81e-75
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000149
Further Details:      
 
Domain Number 3 Region: 313-516
Classification Level Classification E-value
Superfamily Fibronectin type III 2.61e-26
Family Fibronectin type III 0.00055
Further Details:      
 
Domain Number 4 Region: 3-100
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-21
Family MAM domain 0.0000612
Further Details:      
 
Domain Number 5 Region: 207-345
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000305
Family Fibronectin type III 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006435   Gene: ENSTNIG00000003833   Transcript: ENSTNIT00000006584
Sequence length 1355
Comment pep:known_by_projection chromosome:TETRAODON8:21:5724893:5739978:-1 gene:ENSTNIG00000003833 transcript:ENSTNIT00000006584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPTGSFMMVNSSQHLAGQRAQLLLQPLSENDTHCIQFSYFLFSRDGHSPGELQLYVRVN
GGPKGSAVWNTSGSQGRQWHQVELAVSTFWPSEYQLIFSSRRVQEKMRYYCVGHLAHLAS
GLSLSPEHLFPRSSALGAGEGATFVCAQRRNGVLLDAPALSRLSHKRLMAAFQVEAQRGE
QDLYRCVTLSPRGAAVSNFGELIVRVPPTPIAPPQLLRAGPTYLIIQLNTNSIVGDGPVI
RREVRYRASPSTWTETHGVGSLTYKVWHLEPDTQYHISVLLTRPGDGGTGAPGPPLISRT
KCAEPMRALRGLTATDIQPRQLSLRWEPLGYNLTRCHTYTLSLCYRYSVPTGGGGTNNAT
VRECLSVERNTSRFTLRDLPPFHAVHVRLALANPEGKKESREVTFQTEEDVPGGISSESL
SFTPLDDMVFLKWEEPVEPNGLITQYEISYQSIESSDPGINVPGPRRTVSKLRNETYHMF
SGLHPGTTYLVSVRARTAKGFGQSALTEITTNISAPVFDYEDVPSPLSETESTITVLLRP
ALARGAPVSAYQVVVVEEDGSRQVRRREVGSGDCFPASPAAAGRGAPHYYTAELAPSSLP
EATPFTVGDNHTYNGYWNSPLDPTRSYLIYFQATSNFKGETRINCIRIARKAACKDAKRA
LEVSQHAEDMGLILAACVGAPLVLVLLLGALVGVLKKGKKVTLPKASMSYRQEKSRKLSS
IDGGLVEAGPLQLDRRLAPAFMDAHGCASRNEQRSSVTESSSLLGGSPQRRCRRRSSPFH
TGQLHPAVRVADLLQHINQMKTAEGYGFKQEYQSFFDGWDVSKKKDKTKGRHDSLLSHDR
QRPRLPSLLADPCSDYANANYIDGYQRSNHFIATQGPKQEMVYDFWRMVWQENCFSIVMI
TKLLEVGRMKCCKYWPDDSELYGDIKITLLKTETLAEYTVRTFAMERRGYPAKHEVRQFH
FTSWPEHGVPRHATGLLAFLRRVKASTPPDAGPVVVHCSVGAGRTGCYIVLDVMLDMAEC
EGVVDIYNCVKTLCSRRINMIQTEEQYVFIHDAILEACLCGETAIPVSEFALTYKEMLKV
DSQSNTSSLREEFQTLNSVTPHLDVEECSISLLPRNREKNRSMDVLPPDRSLAFLVAADG
ESSSYINAALADSFLRPAAFVVTPHPLPSTTSDFWRLVYDYGCTSVVMLNQLNQSNSAWP
CLQYWPEPGLQQLGPVTVELLSRTADDDVIIRLFRVQNITRLQEGPLLVRHFQFLRWSPY
RDVPDSRKAFLLLAQVHGWQRECGEGRTAVHCLNGGGRSGTFCACTMILEMIRHHSVADA
FFAAKTLRNAKPNMVETMEQYRFCYDLAQEYLECL
Download sequence
Identical sequences H3CDW1
ENSTNIP00000006435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]