SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006475 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006475
Domain Number 1 Region: 533-789
Classification Level Classification E-value
Superfamily SET domain 6.54e-81
Family Histone lysine methyltransferases 0.0000381
Further Details:      
 
Domain Number 2 Region: 267-512
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.32e-60
Family Ankyrin repeat 0.0000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006475   Gene: ENSTNIG00000003872   Transcript: ENSTNIT00000006625
Sequence length 816
Comment pep:known_by_projection chromosome:TETRAODON8:21_random:3256432:3262103:1 gene:ENSTNIG00000003872 transcript:ENSTNIT00000006625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPRHVSLAEGSDAGDMDRLEELPLCSCRMEAPQVDSTSQPVSRQCMATESINGVLRACT
NQTMKGETMRPSSRVPLMVLCEVHRSHMVQHHCCPGCGLFCLAGTFLECCPDQRIAHRFH
RGCVTVLGSGRSRPNEGGMLFCPHCGEDASEAQEVTIPSFRSASSSSSTVVTMSASSTTT
PSLPSTPTALSLTASTGGMKDGKMPERPVSIPAEEGVDSVGPSLCLPNGKPISPSALPPG
ASRAALQKAILTQESERKKKLRFHPRQLYPAAKQGETQRVLLMLMESIDPSYQPDAQNRR
CALHAAAQRGLLEICYMLVQAGANVDAQDKDLRTPLVEAIINNHIEVARYLIQNGACVYH
VEEDGYTGLHHAAKLGNLEIVNMLLETGQVDVNAQDSGGWTPIWAAEHKHLDVIKVLLNR
GADVNIADKVCIQLYKELNVCLHWAAYAGSVDIAELVLNAGCSLSSVNTHGDTPLHIASR
EGYLECVRLFLSRGADIDIMNREGDTPLTLARPETPVWVALQINRKLRRGISNRLHRTER
IICSDIAQGYENVPIPCVNAVDDEGCPSDYKYVSENCETSAMNIDRNITHLQHCSCTDDC
SSSNCLCGQLSIRCWYDKDQRLLQEFNKIEPPLIFECNMACSCHRACKNRVVQSGIKVRL
QLYRTEKMGWGVRALQDIPQGSFICEYVGELISDAEADVREDDSYLFDLDNKDGEVYCID
ARYYGNISRFINHLCDPNIPVRVFMLHQDLRFPRIAFFSSRDILSGQELGFDYGDRFWDI
KSKYFTCQCGSEKCKHSAEAIALEQSRLARLEAGPE
Download sequence
Identical sequences H3CE01
ENSTNIP00000006475 99883.ENSTNIP00000006475 ENSTNIP00000006475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]