SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006503 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006503
Domain Number 1 Region: 438-563
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-29
Family Cadherin 0.0015
Further Details:      
 
Domain Number 2 Region: 233-344
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-26
Family Cadherin 0.00062
Further Details:      
 
Domain Number 3 Region: 124-231
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-21
Family Cadherin 0.0042
Further Details:      
 
Domain Number 4 Region: 338-441
Classification Level Classification E-value
Superfamily Cadherin-like 7.2e-20
Family Cadherin 0.0052
Further Details:      
 
Domain Number 5 Region: 553-662
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000131
Family Cadherin 0.0064
Further Details:      
 
Domain Number 6 Region: 25-122
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000286
Family Cadherin 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006503   Gene: ENSTNIG00000005148   Transcript: ENSTNIT00000006653
Sequence length 948
Comment pep:novel chromosome:TETRAODON8:1:6738349:6798900:1 gene:ENSTNIG00000005148 transcript:ENSTNIT00000006653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRLCKTMTCPAVLFIAVALIGAVQGQVSYSVPEEMKKGSLIGNIAQDFGLDVQRLKSGK
ARIFTGNSANYIELNRERGVLLVKEKIDREALCGQTTPCALHFQIILENPMELYTVTIEV
ADINDNPPLFEKSEMKFKISESATLGSKFVLKRAVDLDVGVNDLQKYELKPTDNFALKLQ
NNADGNQNIEMVLQKPLDREKQEQISLVLTAVDGGEPRMSGTMLILITVLDANDNAPVFT
QSTYKSTVVENSAKGTVVATVTASDADDGANSKITYSITNTLDDVRNLFKINMENGEVVL
IGNLDFEESKRFEIDLRASDEGGLTDSSKLFVDVRDVNDNRPEINIMSKSNVISEDAQIG
TVVTMINVEDKDTGENGKVQCFVNENIPYILKTSSSNFHTLVTDSELDRERESEYNITVS
CSDEGAPSLSSSVTLTLQISDVNDNAPVFERSSYQAYIVENNSPGLSIFTVRARDADWNQ
NARVSYILEESSVNGVPVSSYVSVSADSGVVHAVRSFDYEQIKDFHFLVRAQDGGSPPLS
SNVSVRILIQDQNDNPPQVLYPVQTGGSMVAEMVPRSADVGYLVTKVVAVDVDSGQNAWL
SYKLQKATDRALFEVGLQNGEIRTVRQVSDKDAVKQRLSVIVEDNGQPSRSATVIVNVAV
ADSFPEVLSEFTDFAQDKEYNDNLTFYLVLALAVVSFLFITCLVVIVSVKIYRWRQSRIL
YHSSLPVIPYYPPRYSDTLGTGTLQHVYNYEVCRTTDSRKSDCKLGRAASQNVLIMEPSS
TGTMQRIQSDKSILDERDSPLEQKPPNNDWRFTQGQRPGPSGETGGTETECMDRPWPQPP
TEAEQLQALMATANEVSEATANLGPGTMGLSTRYSPQFTLQHVPDYRQNVYIPGSTATLT
SNPQQQQATAQQAAQQALPPPQASAQPEPPKAAQTPASKKKSTKKEKK
Download sequence
Identical sequences H3CE29
ENSTNIP00000006503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]