SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006504 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006504
Domain Number 1 Region: 224-341
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-30
Family Cadherin 0.00036
Further Details:      
 
Domain Number 2 Region: 434-559
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 121-228
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-22
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 333-437
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-20
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 549-658
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000143
Family Cadherin 0.0035
Further Details:      
 
Domain Number 6 Region: 24-119
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000128
Family Cadherin 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006504   Gene: ENSTNIG00000005148   Transcript: ENSTNIT00000006654
Sequence length 942
Comment pep:novel chromosome:TETRAODON8:1:6750486:6798900:1 gene:ENSTNIG00000005148 transcript:ENSTNIT00000006654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRTMRRQVFFFTMLFSLDSVLGQVSYSIPEEMPKGSVLGNIARDLGLDVKRLKSGKARI
FTGDSAEYIELNRDRGVLLVKDRIDREMLCKQTTPCALHLQIILENPMELFRITVEITDI
NDNSPVFKYEEKLFEISESAVPGSKFVLDRAVDADIGVNGLKNYSLKPSDHFQLRMQHHT
DGNNKVEMVLHKQLDREKEEEMSLLLTAVDGGEPQMSGTVKIFVTVLDVNDNAPVFVQPV
YKAAIAENSQKGTTLTRVSATDADKGRNGEVSYSVSSTMDSVSDIFTVDEKGDVILLGAI
DFEKAKYYQIDIEARDSGGLSDSTKVMIDVIDVNDNSPLIKVVTKSESISENSAPNTVVA
MLNVKDPDSENNGQVQCKINENIPFKIQITSNGFHTLITEVMLDREDRSEYNITVSCSDE
GAPSLSSSVTLTLQISDVNDNAPVFERSSYQAYIVENNSPGLSIFTVRARDADWSQNARV
SYILEESSVNGVPVSSYVSVSADSGVVHAVRSFDYEQIKDFHFLVRAQDGGSPPLSSNVS
VRILIQDQNDNPPQVLYPVQTGGSMVAEMVPRSADVGYLVTKVVAVDVDSGQNAWLSYKL
QKATDRALFEVGLQNGEIRTVRQVSDKDAVKQRLSVIVEDNGQPSRSATVIVNVAVADSF
PEVLSEFTDFAQDKEYNDNLTFYLVLALAVVSFLFITCLVVIVSVKIYRWRQSRILYHSS
LPVIPYYPPRYSDTLGTGTLQHVYNYEVCRTTDSRKSDCKLGRAASQNVLIMEPSSTGTM
QRIQSDKSILDEPDSPLEQKPPNNDWRFTQGQRPGPSGETGGKTECMDRPWPQPPTEAEQ
LQALMATANVSEATANLGPGTMGLSTRYSPQFTLQHVPDYRQNVYIPGSTATLTSNPQQQ
QATAQQAAQQALPPPQASAQPEPPKAAQTPASKKKSTKKEKK
Download sequence
Identical sequences H3CE30
ENSTNIP00000006504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]