SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006521 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006521
Domain Number 1 Region: 535-736
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.02e-31
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 2 Region: 45-130
Classification Level Classification E-value
Superfamily E set domains 0.0000002
Family E-set domains of sugar-utilizing enzymes 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006521   Gene: ENSTNIG00000003914   Transcript: ENSTNIT00000006671
Sequence length 768
Comment pep:known_by_projection chromosome:TETRAODON8:11:1020329:1031434:1 gene:ENSTNIG00000003914 transcript:ENSTNIT00000006671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSVAGSDKSFSEAGNSPDEIGFIMDDVPSVLVVNETFSYHPDPVFEPLSSTGLLELKPGS
PLILKGRNLIPSAPGNTKLNYTVLIGETPCVLTLSETQLVCEWPNLTGEHKVTVRVGGFE
YSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLVIIIVLIAYKRKSRDADRTLKRLQLQMDN
LESRVALECKEGESGGDGRSLALTQLLPAFVPHPPNHFLRLLSLQLTSKAPIQQCGVCFS
LSAFCFSLAANCLPVAGWQAQIIKVMALLGRLAGEREERWSRGISMTVIPELCLLESSHH
LLLHFLNSFGNDILTDLKTQQFLGKKLCQYQFILWVLTEVKLEDGFVYYKKNNKKLHMHH
PVLIEEGSRVTLPHTLHCVNPENENAPEVTVKTLNCDTVTQVKEKLLDAVYKGTPYSQRP
KASDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSVIALVPKQNSAYN
ISNSSTITKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHSDQREGD
RGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKH
SISDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEH
KLGKDSPSNKLLYAKDIPNYKNWVERYYSDISRMSAISDQDMSAYLAEQSRLHVNQFNSM
SALHEIYSYIVKYKDEILSALERDEQARRQLLLRSSLKNYVSLMRIAL
Download sequence
Identical sequences H3CE47
ENSTNIP00000006521 99883.ENSTNIP00000006521 ENSTNIP00000006521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]