SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006524 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006524
Domain Number 1 Region: 3-230
Classification Level Classification E-value
Superfamily Kelch motif 5.36e-68
Family Kelch motif 0.00000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006524   Gene: ENSTNIG00000003916   Transcript: ENSTNIT00000006674
Sequence length 235
Comment pep:known_by_projection chromosome:TETRAODON8:19:7139643:7142390:1 gene:ENSTNIG00000003916 transcript:ENSTNIT00000006674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKT
NQWSSDVAPTSTCRTSVGVAVLGGYLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTR
RLGVAVAVLGGFLYAVGGSDGTSPLNTGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSG
VGLAVVNGQLMAVGGFDGTTYLKTIEVYDPDANTWRLYGGMNYRRLGGGVGVIKM
Download sequence
Identical sequences H3CE50
ENSTNIP00000006524 ENSTNIP00000006524 99883.ENSTNIP00000006524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]