SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006529 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006529
Domain Number 1 Region: 82-299
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-66
Family Ankyrin repeat 0.000000884
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006529   Gene: ENSTNIG00000003921   Transcript: ENSTNIT00000006679
Sequence length 318
Comment pep:known_by_projection chromosome:TETRAODON8:10:2831815:2834369:-1 gene:ENSTNIG00000003921 transcript:ENSTNIT00000006679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLHRTSVLNQMDYSRDPKEGKPAQATDERLDSGLDSLREEEYQAVAAEFHRLRVECEPP
PHKPEPAAAAELPEWKTQVTEDGDTLLHLAIIHEASNHIKPMIALSRNTDFLNLQNHQSQ
TPLHLAVITNQASVCLDLLASGCDPTLVDDRGDTPLHIACRHGNLLCFSVITQHCQPEHR
GRMMAACNYHGENCLHLASVQGFLSLVENLVSLGADINAQEQRNGRSSLHLAVDQQNLSL
VRLLLTRGADPNLVSSGGHTPYHLTYGRHDDDIRRELYSRTDPDLRELPDSELDDSEEEE
DEASDEEVGYDDIQWNGH
Download sequence
Identical sequences H3CE55
ENSTNIP00000006529 99883.ENSTNIP00000006529 ENSTNIP00000006529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]