SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006552 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006552
Domain Number 1 Region: 108-205
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000243
Family Cadherin 0.0074
Further Details:      
 
Domain Number 2 Region: 185-288
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000842
Family Cadherin 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006552
Domain Number - Region: 4-68
Classification Level Classification E-value
Superfamily Cadherin-like 0.000243
Family Cadherin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006552   Gene: ENSTNIG00000003944   Transcript: ENSTNIT00000006703
Sequence length 528
Comment pep:known_by_projection chromosome:TETRAODON8:5:12658602:12660892:-1 gene:ENSTNIG00000003944 transcript:ENSTNIT00000006703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKYFRLENINSPKILVKSVLDYDAVQKVSLVLHVQDIFNGSASNKPFFTSVASITVHVKD
VDNRPPWFQPCSRTSLGMAKLCVSSGYRGRVNLTEKEDGPLVLEPGPLFARDGDKNRSEQ
ISYRILRGNEGNIFQIDEDTGNITMSKAADIAGPITLTVLASQVSNRDQFAVTQVTIEVM
KRSRNPPRFEKDRYEGFIYSNSVPESLILRDRSTYRPFRVRARDEDFASGLNPDVKYEVQ
YSSYVNVTPDGFVVLKRAVKTESFALQLRAVDATTGESGTAALSVQVIPAVATQSPSTIG
YRPGDMALLGLVMAALLVLCLTVIGFLLSRLWRGNGGVDKAFECLPCLRSEQPGPAHGDS
LQYTNDGFQNEADQNRGSSRRWNSTPARRSTFPLSRGRVIPTERRSRHCSSCGVHSNHVP
KGSPLARRGPGDGDQAGARSGRAKPRKEGQKTVWFKESKDSSDIEVEIIPDTVGRVEEET
EEELEVEMEAAVRDPAAPLRGSDGGQENEDAEQREEEEEGQAASKEEA
Download sequence
Identical sequences H3CE78
ENSTNIP00000006552 ENSTNIP00000006552 99883.ENSTNIP00000006552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]