SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006555 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006555
Domain Number 1 Region: 1524-1683
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-45
Family C-type lectin domain 0.00000108
Further Details:      
 
Domain Number 2 Region: 445-554
Classification Level Classification E-value
Superfamily C-type lectin-like 1.28e-41
Family Link domain 0.00076
Further Details:      
 
Domain Number 3 Region: 131-238
Classification Level Classification E-value
Superfamily C-type lectin-like 4.71e-38
Family Link domain 0.0017
Further Details:      
 
Domain Number 4 Region: 234-356
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-27
Family Link domain 0.0024
Further Details:      
 
Domain Number 5 Region: 558-659
Classification Level Classification E-value
Superfamily C-type lectin-like 4.64e-26
Family Link domain 0.0019
Further Details:      
 
Domain Number 6 Region: 1684-1743
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000148
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 16-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000433
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006555
Domain Number - Region: 753-857
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0385
Family WD40-repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006555   Gene: ENSTNIG00000003947   Transcript: ENSTNIT00000006706
Sequence length 1770
Comment pep:known_by_projection chromosome:TETRAODON8:5:12622197:12630957:1 gene:ENSTNIG00000003947 transcript:ENSTNIT00000006706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTDPEDVLSVSIPLEEPQRPLLGQTIFLPCYFEDHTIPDPGAPTIAPLAHRIKWSHVTKE
RATTILVALEGQVRIAEGYLDRVHLLGYPATPTDASIKLSELRSSDSGVYRCEVQHGIED
SHDITHVHVQGLVFHYRAIMGRYSLTFEKATAACAQNSAVVASAEQLQAAFDDGFHQCDA
GWLSDHTVRYPIHDPRVNCYGDKEELPGVRTYGVRDLNETYDVYCFTEKMTGSVFHTTSA
EKFTFSEAVVACSKRGAQLANTGQLYLAWQRGMDVCNAGWLGDRSVRYPINIRRPQCGGG
LLGVRTVYLYTNQTGYPLPESHYDAFCYTAESLEVESSGFGEDGGDVLTVTKVTQTPEVF
FKTTTTTTEGEAVGEVETQRPTAVDFTFTESPTQKPLPQPPNLTEVVTELIEAVTAHPGA
GREIVVKGSQILVNPSPSNGVLRLSTGVVFHYRSGSSRYAFTYVEAQQACQSAGASIATP
EQLQAAYEAGYHQCDAGWLMDQTVRYPIISPRDKCAGDLGEQPGVRSYGLRPADERYDVY
CYIDGLKGEVFHLGSAEGFTYDRAAASCHEQGAVLASTGELYAAWKLGLNKCRPGWLMDR
SVRYPINNPRSECGGGRPGVHTVYAHPNQTSFPSLDSRYDAYCFRGNRLVVINGSFYPVT
VNLLIIANETGLNITDIQEAILNITSISELLRPSKTLQSHRQILTISFGPPVLPPIVVET
SGSGSADFGSGSASGGHSGDFSSSGVQSGSGDQVASGDLSGSGDQVTSGGVSGSGDQVAS
GDLSGSGDQVTSGDLSGSGDQVTSGDLSGSGDQVTSGDLSGSGDQVTSGGASGSGDQVTS
GDLSGSGDQVISGDLSGSGDQSASAELPSGAIRFKQHQNLSGRLLMKKASGIDLLFTATD
SVLSGDGSFSGGPQEAGEGNTGVLRIPLFGSGSGVLSGSGDVSGSGFGSMESGSSLDTSG
ESGQFSGISSGFMNNQDVSGFSGFPSGFASGSGSGIFSGSGDTPILLLDGGLIDESIAVS
QREQELGGGLLAFSGSGDISGSGTSSGDLSGSASGSGSEFFSGVTFVGSGFTELIGSSSG
EQETSGSLLYSGEYASGSGISTFISGSGSASGIVSGFESSASGEGSVTFLREDLFTQSSG
DTSRSLELGQGSVEYSGEGSGSTSALHSASEDNRMFAASGTSSGLSSADLPQVLPPSTSS
EWAPTERSAGAAEALGEAVLAQVSSGAYASHSSALAPAGLAAPPTTAAPGPVGAPGIAME
THHLQGKFTLHTRLFSNLKVLPPAFTGGSNPCEPNPCGAASCSVEGNIALCQGKFPTCEM
VITFVARLWGRWSLCVSVLSNFCHIFSLTVCDCFCGSPGLFFLSLLCLSSSVMHRVFVLL
CPWCLAAGACVSHGRFIVRVLVRRVVAPVSCLCVGCGCLCEHAACAVRCPLSAVCMLTSA
ALTLNQTLICCWNRPDSPADLQRTQKVQPVSLEVAATTVVWTDVSFVWRDRAPRTAPPPP
TPPAETVESPGPFLAEVDVCHSNPCLNGATCVESADSYKCLCLPSYGGRRCQIDEQQCEE
GWTKFQGNCYLHFSDRETWLEAEQRCRDLNAHLASIITPEEQEFVNANAQNYQWIGLNDR
TVQNDFRWTDGTPLQYENWRPNQPDNYFSSGEDCVVMIWHERGQWNDVPCNYHLPFTCKK
GPASCGAPPEVENAYTFGNRREEYPVHSIIRYQCKPGFRQRHAPVVRCRVDGQWEQPQVE
CTDEETYSRKISRCTGHFRCNNGAFHLPSS
Download sequence
Identical sequences H3CE81
ENSTNIP00000006555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]