SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006558 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006558
Domain Number 1 Region: 1498-1623
Classification Level Classification E-value
Superfamily BRCT domain 1.57e-37
Family 53BP1 0.00000939
Further Details:      
 
Domain Number 2 Region: 1334-1402
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.92e-30
Family Tudor domain 0.0000467
Further Details:      
 
Domain Number 3 Region: 1639-1736
Classification Level Classification E-value
Superfamily BRCT domain 2.88e-28
Family 53BP1 0.00037
Further Details:      
 
Domain Number 4 Region: 1281-1333
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.4e-18
Family Tudor domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006558   Gene: ENSTNIG00000003950   Transcript: ENSTNIT00000006709
Sequence length 1737
Comment pep:known_by_projection chromosome:TETRAODON8:5:12565892:12575423:-1 gene:ENSTNIG00000003950 transcript:ENSTNIT00000006709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPGASELESSLPHSENPCLIVEDSQPDSVALEDDPESSYRAVLARRLSSLQPTSRSPVL
ELISSPPGSKHSQGGSQSESSQRSNQETPAAPLRQQSFLANKPCCPLNSDTLNDPNPESQ
QESQVFNLCRPLNKKCAPEDMESGADSTTHCVQAEDGTVNFSFLELSQSQNLGDEVTNCQ
EEEDSIMPQPEHQPKQPIIEKSYNPKVFCYEVRPHELLHVSEVVKRRRRSAPQPQLRITC
SSLFFFFSRSEVSSSSSLDSPVRPAQQVSVQVLLHSQCLQTSEQDGEILSSQQDLFEADK
TGAAVDSTVCEPEQEGQPTPTPGQSLRLLHLSGQGTLAQESLSQSSVDFVASSQISFTNT
PFIVPSSPTGPENEHGTDEPMDTSLPPEDQVREKEEPMDTETASKPHPSASTPVSQNSPG
FTLEGTLSVPSQPEFSHNVFVPTQSQEACSQLGQKPASESQRLDSCPFSMPLQLSVNAES
CDTAQQNSQLVDEDSQATQIEQLEEPPGLHTSVSVAEQPNRTSIVPESQTSSSSQTSCAE
GVKVPSEGAENSSPNVQEEDGKERGSAEVASCSERLDSTDVTVSSCVQETPSDTPPCALT
SPSTIPPTSSASRGEKTAARPPAESSSQISVTVDGAQEGDELGVIDGCEEEEVMEEECTV
SGETLGVALVLSQSQLRTPEPMEEDSVIVVTDSEQESEVLRRDAGSQVPTSSSQPPRGAQ
LVSANGHEPQLPSKKAQGVPGRMSQGEGAGPDAEGVKDKILSDSSGDISFHFTLPKEGDL
IGPVTGATPPLINQLKQSVRHSTPIEISPFAEKSDAAGDVSADVVMAASAIVAGDSGENA
AEKEGGKLSLRMKLVTPVEEVSSDRFSLQKPSLPEEDGAAVKESTVDTVVTSPSVFSRVR
QVHRQKEEEDGAMAVSLCRGELFASPQRGSQASSLGCNSLPNSQPEVLEQEVPQESQKDP
PGPAEHSEDAQDLVRPPETAPVKADAMQRVSQQTFDQSTTSSPTNKPRQRTNFGTPGLHS
PGARVRRFRHTLSTPSAHPRVPPVNTPVLSLKSETESPSARRIAGPSHRRHVRTIKEVRT
TITRIITDVYYEDGKEVERKVSEESEDPVVDCQVLDSDVSPCRTGSSSVTSGDLADISSL
SSKASSLQHSSGGTSSSTGLTRPDFIRPSSRGAKSSSSPRRGGGHPQRGHRVGSVVRGYS
TPGSQASIPLSPRGRARRGRPPSRSGPSSRGGGHSLPRGGPQLPSSSDDEIYTRMLPPQS
PPDTELHGQSDSLRGSPPGSSFVGLRVVAKWSSNGYFYSGRIMKDAGEGRFRLRFDDGYE
CEVAGKDILLCDPIPLETEVTALLEDEYFSIGVVRGHKTEGQELLYSVEKDGQRQWYNRK
AVILSLEQGNKLREQHSLGPYEPSPPLAKASDISLDNLVEGKRRRRGATENTPTRSSSSS
PRTPGPSGKRKLMGSEGSGTPAKRGRRGARAAQQRVGLCNTSGSGTDLPDRSADVVKTHG
PLPQNASLFMGFAFMMTASSESDRLSNKLSSDEEEEYVQTGPYNKTYTESQLQAGGGFIL
PDFNEEQCKAAYQSLLIADQHCRTQKYLLCLASGVPCVSHLWVRDCCKDNKLLNYRNYLL
PAGMGPDDAIVEWHPRCSPFKALRVLLVFEKPTELWAQLITMGGASSVRHVQPDASDIPA
SKFDVVVTDHACPPLVEKNMASQQVPLVSPEWLIQSVICGERLAFHSLPRYRHNYTP
Download sequence
Identical sequences H3CE84
ENSTNIP00000006558 ENSTNIP00000006558 99883.ENSTNIP00000006558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]