SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006566 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006566
Domain Number 1 Region: 72-260
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1e-51
Family Astacin 0.00015
Further Details:      
 
Domain Number 2 Region: 433-604
Classification Level Classification E-value
Superfamily TRAF domain-like 6.21e-30
Family MATH domain 0.0017
Further Details:      
 
Domain Number 3 Region: 268-433
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.2e-28
Family MAM domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006566
Domain Number - Region: 621-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000442
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006566   Gene: ENSTNIG00000003958   Transcript: ENSTNIT00000006717
Sequence length 716
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:250213:255956:-1 gene:ENSTNIG00000003958 transcript:ENSTNIT00000006717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDVRRYPMFAVIATVSVVGLQPTAKIPSKLYFDVDGGRDVDIFDINEAAGLGLVEGDIVV
DERQTRNSIIGEEYRWPKTIPYYMEDDLEVNAKGVILKAFEQYRLKSCIDFKPWSGETNY
ISIFKGNGCFSSVGNRHVGKQRLSIGTNCDRIATIEHEFLHALGFWHEQSRSDRDDYVKI
MWDRITEGKEHNFNTYNDTTSSSLGVPYDYGSMMHYSKTAFSKGNEPTIVTNIPAFSDVI
GQRMEFSDSDLLKLHRLYNCTGGSTFLDSCDFERENICGMIQGQEDKADWVRVASAPGGP
HTDFSNLGKCAGSGYFMHFSTGAANNGDTAQLESRILYPKRGQQCLQFYYYSSAGANDTL
KIYVREYDSANPTGKLRFVETINGPPQEMWQLHHVRLDVKMKFRVVFEGTKEGSGPTEGG
LSLDDINISETTCPEFIWRVKNFTQVMENTPNNQSIFSPPFKSKEGYTFQMQLYPNGTDK
YPGQLGAFAHLVAREGDTGQEWPCPWKQMTMMLMDQHPHIQKRMSNQRSVTTDPNMTATD
SDQFFWDDPRKVGIEVKDTDGSTYFRGPGAGTAVYLTHLRARSRDFIKGGDAIFLLTMED
ISHLVVSQPPPTPSTTPDIPDGCQNVECLNDGVCVLDEGKPTCRCVVGDDWWYYGDRCQK
KGSISEKTTLALASSLSVLGAMVVITVITAICVKRKYKKKAFSNVTAFTLKDMISF
Download sequence
Identical sequences H3CE92
ENSTNIP00000006566 ENSTNIP00000006566 99883.ENSTNIP00000006566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]