SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006576 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006576
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily C-type lectin-like 1.6e-18
Family C-type lectin domain 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006576
Domain Number - Region: 233-306
Classification Level Classification E-value
Superfamily PKD domain 0.000102
Family PKD domain 0.0096
Further Details:      
 
Domain Number - Region: 1417-1446
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 0.0101
Family Lipoxigenase N-terminal domain 0.023
Further Details:      
 
Domain Number - Region: 1360-1443
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 0.0108
Family Lipoxigenase N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006576   Gene: ENSTNIG00000003968   Transcript: ENSTNIT00000006727
Sequence length 2381
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:65025810:65043223:1 gene:ENSTNIG00000003968 transcript:ENSTNIT00000006727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCYEVVGLRYTFSGARAWCEQRGGHLACIPDKETQLFLQRHFDPNEDFWFGARAAPQKLH
KILQGGLSWLDGSPVTSSARARIPQPGSSCGRILGGQEFQWEATSDCTKKLPFICQFGLW
RSTVCGYGSTTLQCCSEQALAVNGGFHGQKNSYYCWSRQPALTTPPHVQCGWVDVTKPQT
VQGLEICAHQMLCDGNQFERACPAKTLISQIYYMNTAGIILSAGSAAAVYDDVAIKVQWL
LQPSGGNFSCKLSTGDGHVINLERPEALEIRVVHRYVHPGTFTVAAQCSSADTDVTACKL
IAVHWPVRAFTSFACYAGNLSLNASNCKALHGEQLQIQMGVNAGSKVTYRILIDNITLPG
FCSWRGNVPVNVTMAPDIIDQLGIGCHHLRIYASNAVTFPDVSTRPNFVICVLEKIHGLQ
ASVLADEEANVDLESITVGVSLERGLPALLLFTLLQNNNSISKSAETNVLKSWLFHAAEL
LYFMSFYVMSFFPFFTAGCMKIKLRAWNTFSSVEVDVDTFATCSKDKDIKTVKYILLHFW
NFTVFRKKNMQELPGLTSHWLSKQYLTQFNECVNIVVITEGLSFVVRKDCLPHPFQFFTY
RFSVINVADNNVDKSQFICITVTPQKALGNTGVRVACKQGCDPATMSKDAIIIWTAKIKY
SHTLFLSLLSLLPDATTTVYTKYTINPRSLQPTATTVPNPHVNVDSFTRPITLGPTSMLP
GNNNGLLTASVGADSLTHLTTPRPTGIIPDCTIAPLSGTMFDAFNITCNTDFICSNCQYC
FRTLQGNPLQCSNNKEVVSIFLPPGNKNLNYDLSIIATAQDGSFVARAIITARVCKRPVG
QNSSSSDDDLVEDIVAKLKKQESVGQIIKVMSDGINSQSSNAEQQKVCLSKLRYLLLRVM
TTTVKTVPITTPAAIQKAARALTDVVRSGSELGSSAAEEASVILANLSAALLQMEVDNSG
EIVMVAKTIVEGVGNILEYASIVGIGSCVIKDCTFISQRNVSDAILMALKNTQRALLKDK
KVNQGPVVIKDDNINMLVDRVTPDRLHRNSIKIPDCFCLAFSLPKLPSTLIPPGEPVDVQ
MLTLDKNPFAWNEGGNISGVVGALSLATQDGSLITVENLSEDIEILIPRPPGAPVVSSVL
DLGNYSTIVIDLPTADSTVLLKLKMVPSVDPLPFKVFLGYYKYPTYTDFVAMAEMPLQGA
ITEEKYTWILRPKDFKGCRGEHYLVVRPVVGAGIKSINASLTITAITAECKFWNESYLDW
SADGCRVGVQTTHLVTQCLCNHLTFFGSSFFVTPNLVDPSRSAELFGTFAENPVVVCFVG
ALFVVYFLVLVWARQKDIQDTTKVKITVLQDNDPLDEYSYLLSVSTVHRRGASTSSQVME
SSVWVKGLATPHKGLAPCHITFKNIDLLRFCHLICRFVGTVMVQDLQTGQKWHFLCNTWL
AIDMGDCSLDKVFPVSTELDLMRFSNLFFMKASKDFSDGHLWYSVISRPPSSTFTRVQRV
SCCFSLLLCTMLTSIMFYGIPSDPSEQTMDLGHFEFTWQQFMIGVQSSLIMFPINILIVS
IFRHTRPREPCCCKRKRDALDMPGRTCFSPTDTQAINDHVTLETVMKDITRITHSLSKSV
KSNIPCTKVELEQQTDINAVLSVMEGFIKQTFKTKPRLPDFQHTLNLKQPIINGLFSEGR
LAAEEFPKKSRMNRIQYLHQQLSHIEKGLRLVGPSGFHSPHSYGQAMQQVKDMRNFLEDH
IFNFSHVDLAEPTHNQTNCCRGGFPWWFIFFGWLLVIATSVVAGYFTMIYGLKFGKERSI
SWLISMIVSFFQSILIIQPLKVVFLAIFFALVIKKVDEEDYQHMAVAENDSHPGELKDPQ
TVRQGSSLYQPPAPADIERMRKNRILEQKAVAGRRECRIHIGFMWMLLLVAYGQRDPNAY
FLQKHIKESFSRNISDSMSLGDVFSWADTVLLRNLFGEHSGFITDGNSKLVGNARVRQLR
VRRNSCQVAGSMQRLVARCHAPYSWEVEDRSSYGPGWNHSSRNQTTGMPNPWTYQTQAEL
RASQAWGRMLLYGGGGFAAELGPDLQNASRTLEYLFSNKWLDGYTRTIFVEFTVYNANVN
LFCIVTLLLETAAVGAFQFTSDLQTVRLYQSTDGLHVFVMAAEIIYMIFILYYMFVQVKL
LKKLRWLYFSCKGNIFELTLIVLSWSAVAVFIKRTLTGNRDMTYYQNNRTQFASFYETAM
ADSTLRYLIAFLVLLSTLKLWRLLRLNPKMNIFTATLQQAWSDITGFLLIIAIMFTAYSI
VSNVMFGWQLSSYRTLARCLVTIISLQIGIFNYDEVLNSQPLLGGFLFGSCIAFMSFMAL
NLLISVILVAFSNEQKHHKPSDDEKIFSLMLGKICSLFGIK
Download sequence
Identical sequences H3CEA2
ENSTNIP00000006576 ENSTNIP00000006576 99883.ENSTNIP00000006576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]