SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006608 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006608
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.48e-24
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006608   Gene: ENSTNIG00000003999   Transcript: ENSTNIT00000006759
Sequence length 110
Comment pep:novel chromosome:TETRAODON8:Un_random:65360281:65361191:1 gene:ENSTNIG00000003999 transcript:ENSTNIT00000006759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYHRPRHYIATQGPMQETVRDFWRMPLLSWVTNLVEVGRVKCVRYWPDETEVYGDIKVTL
IETEPLAEYVIRTFTVQKVNTGRSSSHYLNQLCSAVFFGDPRGHLNITAF
Download sequence
Identical sequences H3CED4
ENSTNIP00000006608 99883.ENSTNIP00000006608 ENSTNIP00000006608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]