SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006628 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006628
Domain Number 1 Region: 147-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.45e-104
Family Transglutaminase core 0.000000000541
Further Details:      
 
Domain Number 2 Region: 6-143
Classification Level Classification E-value
Superfamily E set domains 3.85e-34
Family Transglutaminase N-terminal domain 0.0000071
Further Details:      
 
Domain Number 3 Region: 584-682
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.66e-26
Family Transglutaminase, two C-terminal domains 0.0000106
Further Details:      
 
Domain Number 4 Region: 473-577
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.88e-23
Family Transglutaminase, two C-terminal domains 0.0000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006628   Gene: ENSTNIG00000004019   Transcript: ENSTNIT00000006779
Sequence length 683
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:65545527:65552380:1 gene:ENSTNIG00000004019 transcript:ENSTNIT00000006779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPVPDVSVDLRCRENNRAHRTWEIDRERLIVRRGQPFSVTLQGHRPLTPQHYLDLVLHLA
VPSGPGKRDELVVKVQEGPAPGGRWWFSQWRVQDETVLTLHSPADAAIGHYRLSVSVMSA
GGNVVELVEKVQFHLLFNPWCKDDPPCTFPDELLLKEYVMNEDGIIYMGSWDYIRSIPWS
YGQFEDYVLDICFEVLDKSNKALKNASKDLSHRSDPVYVGRTVTAMVNANDDRGVLAGRW
AESYPDGVSPSRWSGSVPILQQWSKAGPVKYGQCWVFAAVACTVLRCLGVPTRVITNFNS
AHDVDGNLSLDFLVDERLESRGQKGQPMVGGRRTSTVGVESWMKRNDLPDGNHGWQVLDP
TPQELSGGEFCCGPCPVVAIKEGNLKVKYDASFIFAEVNADIVHWMVYGDGRREKGGPPQ
RGRNISTKSPFGYTREDVTEQYKYPEAGSSKEREVYSKAGRQTEAPAGPEPEPLQLSIKH
TTAVFGTDFDVVVEVKNGQNSSAGGDLTVLAKVVNYTSLCRGECRRQSASVSVPARSAHK
EVLRLRYEDYAAWTSEDHLIRVEAFLRPSGTSPIMAVATIPLSTPELLVQVPGKALVWEQ
VTAYISFTNPLPVPLRWGVFTVEGAGLLLATQVPLHEPVGPGQQVSVELAFSPLRAGLRH
LLVDFDSDRLKDVKGTTTVDVQK
Download sequence
Identical sequences H3CEF4
ENSTNIP00000006628 99883.ENSTNIP00000006628 ENSTNIP00000006628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]