SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006641 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006641
Domain Number 1 Region: 125-241
Classification Level Classification E-value
Superfamily PX domain 1.09e-22
Family PX domain 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006641
Domain Number - Region: 240-316
Classification Level Classification E-value
Superfamily TPR-like 0.00114
Family BTAD-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006641   Gene: ENSTNIG00000004031   Transcript: ENSTNIT00000006792
Sequence length 381
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:65645398:65647948:-1 gene:ENSTNIG00000004031 transcript:ENSTNIT00000006792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRLLHRLRRSLFKDPQGVGPEPGSAEVSGDSWEAELEEEEECVSHRLGGKLCFDSGQE
GGAEDEDEGSGQDSDSDILGESMEEGLSSADTSPAGPSVAPAADSWRGGVSEASPSVAGG
RRAADALLFEVTDASIVRDGASKYVLYTIHVIQAGGSDKTPAVITRRYSEFQKLHVRLCR
NHGEQMERVCFPRKKLRRNFTAETIAKRSRAFEQYLSHLRSVAVLREAPCVRQFFYLPDL
QAGQMLIRLERYQEALGPLLNAKRLQQKLGWATEDERPGAPASPHWFYTLVALLSCFQEV
EQLEEARDHCQRAVCVLVPALALLLHPLLLPLSQALVGLSWRTGRDKRRWEELLQNLEEE
EEAGLDPGAAIREFLLKHRLE
Download sequence
Identical sequences H3CEG7
ENSTNIP00000006641 ENSTNIP00000006641 99883.ENSTNIP00000006641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]